Engineering protein assemblies with allosteric control via monomer fold-switching
Abstract
The macromolecular machines of life use allosteric control to self-assemble, dissociate and change shape in response to signals. Despite enormous interest, the design of nanoscale allosteric assemblies has proven tremendously challenging. Here we present a proof of concept of allosteric assembly in which an engineered fold switch on the protein monomer triggers or blocks assembly. Our design is based on the hyper-stable, naturally monomeric protein CI2, a paradigm of simple two-state folding, and the toroidal arrangement with 6-fold symmetry that it only adopts in crystalline form. We engineer CI2 to enable a switch between the native and an alternate, latent fold that self-assembles onto hexagonal toroidal particles by exposing a favorable inter-monomer interface. The assembly is controlled on demand via the competing effects of temperature and a designed short peptide. These findings unveil a remarkable potential for structural metamorphosis in proteins and demonstrate key principles for engineering protein-based nanomachinery.
Article type: Research Article
Keywords: Protein folding, Structural biology, Molecular engineering, Nanobiotechnology, Computational biophysics
Affiliations: 0004 1794 1018grid.428469.5Centro Nacional de Biotecnología (CNB-CSIC), Darwin 3, Campus de Cantoblanco, 28049 Madrid, Spain; 0004 0500 5230grid.429045.eUnidad Asociada de Nanobiotecnología IMDEA Nanociencia-CNB, Madrid, Spain; 0004 1936 7603grid.5337.2Present Address: School of Biochemistry, University of Bristol, Bristol, BS8 1TD UK; 0004 1794 0752grid.418281.6Centro de Investigaciones Biológicas (CIB-CSIC), Ramiro de Maeztu 9, 28040 Madrid, Spain; grid.4489.1Departamento de Química Física, Facultad de Ciencias, Universidad de Granada, Campus Fuentenueva s/n, 18071 Granada, Spain; 0001 0049 1282grid.266096.dDepartment of Bioengineering, University of California, 95343 Merced, CA USA; 0001 0049 1282grid.266096.dNSF-CREST Center for Cellular and Biomolecular Machines, University of California, 95343 Merced, CA USA; IMDEA Nanociencia, Programa de Nanobiosistemas, Faraday 9, Ciudad Universitaria Cantoblanco, 28049 Madrid, Spain
License: © The Author(s) 2019 CC BY 4.0 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
Article links: DOI: 10.1038/s41467-019-13686-1 | PubMed: 31836707 | PMC: PMC6911049
Relevance: Moderate: mentioned 3+ times in text
Full text: PDF (4.2 MB)
Introduction
The molecular machinery in charge of all biological processes is based on protein assemblies1. Such nanoscale machines perform sophisticated functions by exploiting the ability of proteins to use thermal, and occasionally chemical, energy to interact and change shape in response to specific stimuli2. Accordingly, a large percentage of the proteome consists of proteins that form macromolecular complexes in their functional state3. The catalog of biological assemblies is, however, limited in variety and highly conserved through evolution4. Learning how to design and engineer protein assemblies and understanding their modes of operation is thus of enormous interest.
The engineering of protein assemblies has become a major research thrust, with recent developments breaking new ground5. The most direct approach builds assemblies based on protein–protein interaction domains that already exist in nature6. In early implementations, redesigning the leucine-zipper motif permitted to obtain α-helical coiled-coil complexes containing up to seven monomers7. Larger assemblies that organize into nanoscale objects such as filaments, cages, or layers have been later achieved by joining together various oligomerization domains8–10. Building assemblies from globular proteins that are naturally monomeric is more challenging. In this regard, it has been noted that the crystal lattice from X-ray structures hints at the preferred packing symmetry and potential interaction interface between monomers11,12. Once the assembly interface is identified from the crystal, computational optimization of the interface can lead to designed protein sequences that form stable assemblies13–15. Most recently, a hybrid approach that combines existing oligomerization domains and in silico optimization has rendered spectacular results, producing tetrahedral and icosahedral cages16,17, which can be functionalized by gene fusion to form encapsulated protein nanoscale cages that mimic virus assembly18.
In addition to static rigid assemblies, major strides have been made in the last years in engineering dynamic protein arrangements that incorporate mechanisms to control the assembly process and/or the stoichiometry19,20. The engineering of metal coordination motifs21,22, bivalent drug binding23, and disulfide bonds24 onto various protein scaffolds have been used as strategies to enable templated assembly of protein monomers in ways that respond to external cues. Scientists have exploited these strategies to produce protein assemblies that grow in one dimension to make nanowires23 and nanotubes21 that can self-close to form nanorings25, or that grow in two and three dimensions leading to various crystalline arrangements21,26. One advantage of templated assembly is its generalizability to virtually any protein scaffold using straightforward protein engineering tools, including the possibility of reverse engineering natural protein assemblies27. The main advantage is, of course, that the assembly process becomes controllable by an external cue, for example, the concentration of a bivalent drug23, or even multiple cues, such as metal concentration, pH and chelators21,22, or metal identity, redox potential, and mechanical stress28. The combination of two of these mechanisms leads to even more sophisticated behavior, such as the re-creation of an allosteric transition by introducing structural strain between metal binding and disulfide bond formation on a designed protein tetramer29,30.
These strategies are captivating, but still engineer proteins as modular building blocks without taking full advantage of their ability to experience conformational transitions that drastically change their functional properties (binding, assembly, catalysis) in response to stimuli. Here we tackle this challenge by introducing an approach to build allosteric protein complexes in which the assembly–disassembly process is controlled externally through an engineered fold switch. We start by defining the symmetry and stoichiometry of assembly from the crystal lattice arrangement of the monomeric protein, thereby extending an approach used before to design dimer interfaces on globular proteins13. To implement allosteric control, we aim at thermodynamically coupling the assembly process to a fold-switch transition in the monomer (Fig. 1). Fold switching is a relatively recently discovered phenomenon in which a “metamorphic” protein alternates between two different folds31–33. Metamorphic proteins play complex regulatory roles34, such as the ticking mechanism of circadian clocks35. The key to this approach is that assembly occurs via the oligomerization of an alternate fold, which exposes a potential assembly interface that is hidden in the native structure. The exposure/burial of oligomerization interfaces upon fold switching is common to metamorphic proteins32,35,36. From an engineering viewpoint, we note that the alternate fold must be metastable in the monomer, so that assembly can be blocked or triggered on cue by controlling the stability of the native ground state (e.g., by temperature, counterions, binding to an effector) and/or protein concentration. On these conditions, the alternate fold will operate as an allosteric switch for assembly37,38.

Results
A protein scaffold for building allosteric assemblies
As scaffold for implementing fold-switched allosteric assemblies, we chose chymotrypsin inhibitor 2 (CI2) from barley seeds. At first glance, CI2 seems an unseemly election. The small (<70 residues) globular single-domain CI2 is a paradigm of two-state folding in which a sturdy native structure unfolds at an extremely slow rate via an all-or-none transition39. In solution, we find that CI2 is monomeric at concentrations up to the millimolar range (Supplementary Fig. 1) and remains monomeric even after unfolding partially at high temperatures (Supplementary Fig. 2). There are, however, structural hints of metamorphic potential. The CI2 native structure contains a four-stranded β-sheet and one α-helix connecting strands 1 and 2 (Fig. 2a). The C-terminal β-strand is inserted in antiparallel fashion into the sheet’s middle, breaking an otherwise parallel arrangement to form a unique fold that is specific to this family of serine protease inhibitors (Supplementary Fig. 3). It is of note that removal of that last strand (dark blue in Fig. 2a) would transform the CI2 topology onto an elementary Rossmann fold, which is one of the most common natural protein architectures40. Sequence conservation among CI2 orthologs also unveils evolutionary pressure to keep the C-terminal β-strand inserted, including the addition of a disulfide crosslink in the sub-family of trypsin inhibitors (Fig. 2a, Supplementary Fig. 3).

To identify possible spatial arrangements for assembly, we analyzed the crystal lattice of CI2 by X-ray crystallography. CI2 crystallizes in the hexagonal space group P622 in all the conditions we attempted that rendered crystals (Table 1 and Supplementary Table 1). On the lattice, the protein forms double hexameric rings in which the two rings are packed head to head and rotated by ~30° (Fig. 2b). This spatial arrangement is strongly predefined by symmetry, and thus we identify the toroidal D6 particles of the crystal as the target for engineering a CI2 assembly. The lattice also reveals that inter-monomer contacts are few and feeble, both between ring neighbors (Fig. 2c) and across rings (Fig. 2d, left), explaining why the protein is monomeric at all conditions outside the crystal (see also Supplementary Fig. 4). An unexpected discovery was that we observed domain swapping at certain crystallization conditions. Indeed, crystals obtained using salt as primary precipitant (Supplementary Table 1) follow the standard arrangement of early structural work on CI241 (Fig. 2d, left), whereas crystals grown with PEG feature domain-swapped dimers arranged in the same lattice structure and group symmetry (Fig. 2d, right). In domain-swapped crystals, equivalent monomers on the two rings exchange their C-terminal segments (residues 39–66; see Fig. 2a) to form dimers that covalently link the rings via the active loops (Fig. 2d, right). Domain swapping does not affect the monomer–monomer interface of each ring, and thus is unable to self-sufficiently promote assembly in solution, but it does demonstrate an inherent tendency of the C terminus of CI2 to unwind, and the robustness of the toroidal D6 packing symmetry for this protein.
Table 1: Data collection and refinement statistics.
| Classical geometry (condition a) | Domain swapping (condition b) | |
|---|---|---|
| Data collection | ||
| Space group | P622 | P622 |
| Cell dimensions | ||
| a, b, c (Å) | 68.77, 68.77, 50.56 | 68.55, 68.55, 53.10 |
| α, β, γ (°) | 90, 90, 120 | 90, 90, 120 |
| Resolution (Å) | 34.39–1.50 (1.55–1.50) | 39.58–1.65 (1.71–1.65) |
| Rmerge | 0.059 (2.059) | 0.083 (1.195) |
| I /σI | 23.00 (1.80) | 15.20 (1.60) |
| Completeness (%) | 99.50 (99.65) | 99.84 (99.23) |
| Redundancy | 18.1 (18.3) | 8.3 (8.3) |
| Refinement | ||
| Resolution (Å) | 34.39–1.50 (1.55–1.50) | 39.58–1.65 (1.71–1.65) |
| No. of reflections | 11,750 (1143) | 9305 (903) |
| Rwork/Rfree | 0.21 (0.35)/0.26 (0.37) | 0.18 (0.27)/0.22 (0.34) |
| No. of atoms | ||
| Protein | 527 | 529 |
| Ligand/ion | – | – |
| Water | 65 | 97 |
| B-factors | ||
| Protein | 37.53 | 26.38 |
| Ligand/ion | – | – |
| Water | 43.44 | 37.83 |
| R.m.s. deviations | ||
| Bond lengths (Å) | 0.006 | 0.006 |
| Bond angles (°) | 0.86 | 0.86 |
Values within parentheses are for highest-resolution shell
Engineering CI2 to fold switch and oligomerize
Rather than optimizing the weak inter-monomer contacts of the crystal lattice (Fig. 1c, Supplementary Fig. 4), which would just produce a rigid assembly, we targeted the monomer conformational properties aiming to drive assembly via a fold switch. This strategy is inspired by naturally metamorphic proteins, in which one of the alternate folds often exposes a sticky interface for oligomerization31,42,43. One key to fold switching is for the monomeric fold to be on the brink of stability so that the metastable, assembly-prone fold can eventually compete42. Inspired by previous attempts to design fold switchers44,45, we targeted specific CI2 residues that are away from the inter-monomer interface of the crystal (Fig. 2c), participate in defining the native topology (particularly in keeping the antiparallel last strand inserted between strands 1 and 3, see Fig. 2a), but are not highly conserved within the family of serine protease inhibitors (Supplementary Fig. 3). We selected 10 such locations scattered throughout the CI2 sequence and designed mutations on them that: (1) are conservative in both structure and sequence; (2) increase the intrinsic propensity to form the native secondary structure elements (minimize folding cooperativity46); and (3) scramble the packing of the two native hydrophobic mini-cores while they maintain the overall hydrophobicity of the protein. The final set of designed mutations is shown on the CI2 structure in Fig. 2e. Further mutational details are given in Supplementary Table 2 and the Methods section. We then produced a suitably engineered CI2 version (CI2eng) as the basis for our study. To investigate the structural properties of the CI2eng monomer, we used multidimensional nuclear magnetic resonance (NMR) on a 15N-13C isotopically labeled sample. From the chemical shifts, we obtained a three-dimensional (3D) structure employing CS-Rosetta47, which shows that the engineered monomer conserves the native fold (Fig. 2f). CI2eng also maintains biological activity, as shown on enzymatic inhibition assays (Supplementary Fig. 5). Equilibrium and kinetic chemical denaturation experiments reveal that the native fold of CI2eng has basal stability (Fig. 2g, h), thus meeting our first design criterion. Moreover, the induced destabilization arises from a highly accelerated unfolding rate (~300-fold) without significant slowdown of the folding rate (Fig. 2h). A much faster unfolding rate meets a second design criterion by facilitating the opening of the native structure that is required to enable fold switching42.
Formation of toroidal assemblies in solution
Size-exclusion chromatography of CI2eng at concentrations above those used for the previous folding studies revealed specific oligomerization consistent with a mixture of single (H) and double (H2) hexamers in addition to the monomer (M) (Fig. 3a). Combining size-exclusion chromatography and multi-angle light scattering, we could determine a molecular mass of ~7 kDa for the monomer peak, and a mixture of two species with masses of ~44 kDa (consistent with H) and ~88 kDa (consistent with H2) for the polydisperse peak (Supplementary Fig. 6). Further analysis of sedimentation velocities, determined by analytical ultracentrifugation at different concentrations, fully resolves the two complexes with sedimentation coefficients consistent with H and H2 particles (Fig. 3b). Both methods show the populations of M, H, and H2 changing with protein concentration, as expected for a dynamic equilibrium between monomer and assembly (Supplementary Fig. 7).

To determine the structural properties in solution of the CI2eng self-assembled particles, we used electron microscopy (EM) (see Methods). We first carried out standard negative staining analysis (Supplementary Fig. 8), which showed large populations of ring-like structures. The ring particles have size consistent with the expectation for negatively stained double hexamers (12 × 7 kDa) and a distinct 6-fold symmetry equivalent to that found in the wild-type crystal lattice. Subsequently, we performed cryo-electron microscopy (cryo-EM) to derive a structural model of the assembled particle without fixation and staining. Figure 2c shows a cryo-EM image of a vitrified CI2eng sample taken at 120,000 × magnification that highlights the <100 Å particles (near the size limit for cryo-EM) that CI2eng forms in solution. The two most common particle views have either doughnut-like shape with distinct 6-fold symmetry or roughly rectangular shape (arrows and arrowheads in Fig. 3c, respectively). These shapes are consistent with top and side projections of a double hexameric toroid (see 2D classes in Fig. 3c). Large-scale data acquisition, followed by image processing and automatic 2D classification, rendered a total of 710,000 particles. This extensive dataset displays certain morphological heterogeneity, with particles that look like broken or deformed versions of those highlighted in Fig. 3c and observed by negative staining (Supplementary Fig. 8). Such heterogeneity arises from the highly dynamic equilibrium for assembly, which includes single hexamers (Fig. 3b and Supplementary Fig. 6) in addition to debris from the inevitable equilibrium perturbation that takes place during cryo-EM sample preparation. Nevertheless, the most populated classes represent different views of a double-ring with D6 symmetry (Fig. 3c, right). A total of 115,000 particles associated with these classes were subjected to multiple rounds of 3D classification imposing D6 symmetry, 3D refinement, and post-processing to render a final 3D reconstruction of the toroidal particles (Fig. 3d). The 3D structure, obtained at a resolution of 8.55 Å (Supplementary Fig. 9), represents an ~65 Å wide and an ~55 Å high toroidal particle with a channel of ~15 Å in diameter. The resolution is not high enough to determine individual secondary structure elements, but it does resolve the monomers and their orientation based on their sole α-helix. The cryo-EM structure reveals tight contacts between adjacent monomers in each ring. The two rings are placed head to head and staggered, have an ~5 Å gap between them, and interact through weak contacts. We can thus conclude that CI2eng self-assembles in solution onto D6 toroidal structures that replicate the wild-type crystalline arrangement.
Assembly involves a fold-switch transition in the monomer
The thermodynamic scheme of Fig. 1 requires a conformational switch as driver of assembly. Two early pieces of evidence point to the occurrence of a conformational switch on CI2eng upon assembly. The first evidence comes from the cryo-EM 3D reconstruction, which shows that the monomer density is too narrow to accommodate the entire native β-sheet (Fig. 4a). The second evidence comes from thermal denaturation experiments. If the assembly were composed of native monomers, raising the protein concentration should stabilize the native structure, as it generally happens in the denaturation of oligomeric proteins48. However, we observe a strong destabilization of the CI2eng native fold upon increasing protein concentration, whether monitored by fluorescence (Fig. 4b) or far-ultraviolet (UV) circular dichroism (CD) (Supplementary Fig. 10), whereas the thermal unfolding of CI2 is concentration insensitive, as expected for a monomeric protein. The thermodynamic behavior of CI2eng strongly suggests that the assembly process involves a switch from the native to an alternate conformation.

Although thermal denaturation experiments by tryptophan fluorescence (Fig. 4b) and the far-UV CD signal at 222 nm (Supplementary Fig. 10) show what appears to be a single transition, analysis of the far-UV CD spectra as a function of temperature reveals a double transition that is most apparent at 217 nm (Supplementary Fig. 11). CD spectra from the three plateau regions (roughly corresponding to the three observed species) are shown in Fig. 4c. As in CI2, the native spectrum (N in Fig. 4c) of CI2eng is dominated by the contribution from the tertiary environment of the sole tryptophan (W7). The spectrum from the intermediate plateau indicates that the alternate conformation that forms upon assembly is highly structured, containing a mix of α-helix and β-sheet, but missing the asymmetric tertiary environment around W7 (FS in Fig. 4c). Finally, the spectrum at high temperature represents the thermally unfolded monomer (U in Fig. 4c). The difference spectra (N-FS and FS-U) reveal that the first transition involves breaking the tertiary environment of W7, in agreement with the loss of the entire fluorescence signal, whereas the second transition involves melting of the β-sheet to produce an unfolded state with residual α-helix content (Fig. 4d).
To investigate in situ the conformational switch coupled to assembly that takes place at intermediate temperatures and/or higher protein concentration, we employed solution NMR. The CI2eng assemblies are expected to be invisible to conventional NMR detection due to extreme spectral line broadening caused by the slow tumbling rates associated to their size49. NMR should thus only show the signals of the CI2eng monomer population, which folds into the same native structure of CI2 (Fig. 2f). Interestingly, NMR spectra obtained in conditions at which CI2eng is about 85% assembled (Fig. 4e) show all the signals corresponding to the small population of native monomer that remains in solution (blue), but also show nine extra cross-peaks with about six-fold higher intensity (red). The relative intensity of the extra cross-peaks versus that of the ones corresponding to the native monomer changes with protein concentration in the same manner than the assembly-monomer ratio does (Supplementary Fig. 12), thereby confirming that the extra cross-peaks belong to the assembled monomer. Sequential assignment indicates that these signals are from the C-terminal segment of the protein: last β-strand and end of the prior loop. Their 1H chemical shift values cluster within the 8–8.5 p.p.m. range, in contrast to the large spread that the same signals experience in the native monomer (Fig. 4e), thus indicating that they correspond to an unstructured and flexible segment. From these observations, we can conclude that the alternate conformation that is formed upon assembly results in the disordering of the C-terminal segment of CI2eng, which becomes visible by NMR due to its enhanced conformational dynamics. This key result demonstrates that forming the assembly involves a conformational transition of the monomer, as per the thermodynamic scheme of Fig. 1. The conformational change disrupts the tertiary environment around W7, which renders it monitorable by fluorescence and CD signals (Fig. 4a, Supplementary Figs. 10 and 11). The structural change involves a few residues, but it requires a drastic reorganization of the monomer’s fold because the C-terminal strand is central within the native β-sheet and hydrophobic core (see Fig. 2a).
To further characterize the structural reorganization of the assembled monomer, we performed all atom molecular dynamics (MD) simulations. As starting point for the simulations, we built a structural model in which the C-terminal strand is detached from the core (Fig. 5a, cyan), and, as negative control, a model with the N-terminal strand unraveled (Fig. 5b, light green). In the control simulations, we observed the quick reconfiguration of the N-strand that snaps back to reform the native CI2 fold (Fig. 5b, dark green). Unraveling of the C-terminal strand, however, triggers a large reorganization in which the N-terminal strand grows longer and joins strands 2–3 to form a stable parallel β-sheet, whereas the C-terminal tail remains free and unstructured (Fig. 5a, dark blue). Both transitions occurred consistently in several trajectories (Fig. 5a, b), indicating that the results are statistically robust (see Methods). We thus take the average final structure from the C-terminal MD simulations (dark blue in Fig. 5a) as structural model of the assembled CI2eng monomer. This structure represents a true fold switch in which the native antiparallel topology of CI2 is transformed onto a three-stranded, all-parallel elementary Rossmann fold.

Atomic-resolution structural model of the assembly
We generated a structural model of the toroidal assembly at atomic resolution based on the CI2eng fold-switched conformation. We started by fitting the fold-switched structure to the electron density obtained by segmentation of the cryo-EM 3D reconstruction (Fig. 6a). This fit scores much better than the best fit to the native fold because the more slender three-stranded sheet of the fold-switched conformation does fit well within the density: root mean square density (RMSD) in Rosetta of −3.42 versus the −3.15Edens/res we obtained for the best fit to the native structure (Fig. 4a). We then generated a symmetric dodecamer of fold-switched monomers and fitted it to the density of the entire particle by allowing Cartesian and angular rigid body reorientations of the monomers (see Methods). The resulting atomic-resolution model of the toroidal assembly is shown in Fig. 6b. Notably, this structure solves the last piece of the mechanistic puzzle, namely, how the fold-switch transition stabilizes the assembly. Since the CI2eng alternate fold is metastable, to effectively compete with the more stable native fold, it must introduce strongly stabilizing inter-monomer interactions upon forming the assembly. The structural model of assembly does indeed reveal a highly optimized inter-monomer interface (Fig. 6c). The alternate fold exposes a new patch of hydrophobic surface that enables a large contact interface between the elongated first strand (W7, L10 and V11) of one monomer and residues from the opposite edge (L23, I31, V33, L56) of the adjacent monomer (Fig. 6c, left). In addition, the structural model reveals a tight network of inter-monomer salt bridges that provides additional stabilization to the rings, and specificity to lock the monomer–monomer orientation within each ring (Fig. 6c, right).

Optimizing assembly via the fold-switched monomer
CI2eng spontaneously forms toroidal assemblies, but it does so with moderate propensity (Supplementary Fig. 7). As strategy for optimizing the assembly and testing the mechanism, we decided to fine tune the stability of the switched fold. The switch involves unwinding the C-terminal β-strand (Figs. 4e and 5) and breaking the native interactions formed by its three hydrophobic residues. Out of these three, the innermost residue (I59) stands out as key stabilizer of the native fold (Fig. 7a, magenta). We tested the role of I59 as native-fold gatekeeper on CI2eng by truncating its side chain (replacement to Ala). As we expected, the I59A mutation greatly enhanced the propensity to spontaneously form toroidal assemblies (Fig. 7b). In fact, whereas CI2eng needs millimolar concentrations to assemble at room temperature (blue), I59A-CI2eng readily assembles in the micromolar range, becoming nearly fully assembled at ~100 μM (magenta). Moreover, assembly of I59A-CI2eng takes place via the same monomer fold switching observed in CI2eng, as inferred from fluorescence and CD experiments (Supplementary Fig. 13). As further test, we used an alternative approach based on excising the entire C-terminal β-strand on the wild-type sequence (CI21–58, Fig. 7a, green). CI21–58 exhibits a similarly enhanced propensity to assemble (green). Our results on these two reengineered variants confirm the key role that the C-terminal β-strand plays in the monomer fold switch. They also provide practical demonstration of how to tune up the assembly process without targeting the monomer–monomer interface.

Allosteric control of assembly
The fold-switching transition in the monomer should permit to trigger or block the assembly process in response to cues. To investigate this possibility, we first focused on temperature as effector. Since the enthalpy of unfolding the metastable fold switch is much smaller than the enthalpy of unfolding the native state, a moderate increase in temperature should promote the monomer conversion from native to alternate fold and thus enhance assembly. This behavior is diagnostic because it is the exact opposite to conventional temperature effects on protein assembly48. Using differential scanning calorimetry (DSC), we could detect two distinct, concentration-dependent transitions on CI2eng (Fig. 7c). At the lowest concentrations only one transition is observable, representing the thermal unfolding of the native monomer in the absence of assembly (peak at ~337 K), as we previously observed by fluorescence (Fig. 4b) and CD (Supplementary Fig. 10) experiments. At higher concentrations, the DSC profile splits into two peaks that move gradually apart as protein concentration increases (Fig. 7c, e). These observations are consistent with previous CD experiments (Supplementary Figs. 10 and 11) and indicative of negatively coupled transitions: one transition promoted and one hindered by protein concentration (Fig. 7e). The early, concentration-promoted transition involves the fold switch of the monomer followed by assembly. The late transition corresponds to dissociation of the assembly onto unfolded monomers. Experimental reruns showed a reasonable degree of reversibility when the samples were incubated for sufficiently long times (e.g., several hours) in between runs (Supplementary Fig. 14), confirming that the process is under thermodynamic control. These experiments demonstrate that moderate changes in temperature within the physiologically relevant range can control assembly in a reversible fashion. For example, at 0.6 mM and ~305 K, CI2eng is mostly native and monomeric, but a 15° jump can trigger the fold switch and achieve nearly complete oligomerization (dark blue in Fig. 7c). The assembly optimized variants (I59A-CI2eng and CI21–58) exhibit the same general features (Fig. 7d, e), demonstrating that the allosteric switch is retained. The quantitative differences among variants reveal the mechanistic bases for their optimization of assembly (Fig. 7e). For instance, the I59A mutation (magenta) promotes the monomer conversion (lower T1) without affecting the stability of the assembled particle (same T2). CI21–58 (green) promotes the fold switch even more vigorously, but also makes a less stable assembly, presumably owing to increased conformational flexibility. These compensatory effects result on similar net propensity to assemble for the two optimized variants (Fig. 7b).
Temperature effects demonstrate the allosteric switch operation. However, practically, it is much more interesting to achieve allosteric control by a molecule. We designed CI21–58 with this goal in mind. The idea was to use a peptide containing the truncated 59–66 region (sequence Ac-IAEVPRVG, see Methods), which we term C-peptide, as external stabilizer of the native fold, and thus as negative allosteric effector for assembly. In experiments at very low protein concentration (2 μM), we find that the C-peptide does bind to the CI21–58 monomer and reverts it to the native fold (Supplementary Fig. 15). More relevantly, addition of the C-peptide to a pre-assembled 80 μM sample of CI21–58 dissolves the assembled particles onto native monomers, demonstrating its role as negative allosteric effector for assembly (Fig. 7f). The inhibitory effect of the C-peptide on assembly is also fully reversible (Fig. 7f, inset), confirming this molecule is a bona fide allosteric effector. Finally, C-peptide and temperature compete so that higher C-peptide concentrations are needed to dissolve the more stable assemblies formed at moderately higher temperatures (Fig. 7f, yellow). The two effectors together enable a fine external control of assembly.
Discussion
We have engineered an allosteric protein assembly using the monomeric, two-state folding protein CI2 as scaffold. The toroidal assemblies with D6 symmetry formed by our engineered variants replicate the symmetry and stoichiometry of the wild-type’s crystalline arrangement. What is special here is that we drove assembly without targeting the inter-monomer interface of the target complex. Our strategy was to promote a latent fold-switch transition in the monomer. The switch involves the unwinding of the C-terminal strand and the reorganization of the remaining β-sheet onto an elementary, all-parallel Rossmann fold. This metastable, alternate fold exposes a hydrophobic patch that creates an inter-monomer interface to stabilize the complex. Coupling between oligomerization and monomer fold switching introduces allosteric control via the thermodynamic mechanism shown in Fig. 1 (Fig. 8). In CI2, a protein evolved as a hyper-stable protease inhibitor, the alternate fold is latent (only the U–N equilibrium is observed, gray left arrow in Fig. 8). However, upon engineering its sequence to accelerate the native unfolding rate, the switched fold emerges and triggers assembly on cue (blue top arrow). Because the alternate fold acts as gatekeeper, its targeted stabilization—removing an extra key aliphatic side chain (magenta top arrow) or just excising the last native β-strand (green top arrow)—further promotes the assembly without directly acting on the inter-monomer interface. External control of assembly is exerted by temperature (positive effector) on all the engineered variants, and by the C-peptide (negative allosteric effector) on CI21–58 (top green).

Our results open a new research avenue towards the development of allosteric macromolecular assemblies based on engineering the conformational properties of the monomer. Recently developed templated assembly strategies have led to the implementation of controllable assemblies of protein building blocks that are able to respond to multiple cues19,20,29. In parallel, the natural open-closed conformational transition of an ATP-driven protein complex has been successfully reprogrammed to enable light-induced control via an engineered photo-switchable crosslink50. In this work, we combine both abilities by engineering a fold-switch transition on the protein monomer, and effectively coupling it to the formation of D6 toroidal assemblies in solution; assemblies that are otherwise only found in the crystalline form. The conformational transition acts as an allosteric switch that responds to multiple, competing cues, such as temperature and C-peptide. Control is also exerted at the functional level because the only species with protease inhibitor activity is the native monomer. There are many potential nanotechnological and biomedical applications for such assemblies, including macromolecular on-demand drug delivery systems. For instance, the operational principles we develop here could be used to engineer biopharmaceutical target proteins that form non-functional assemblies for in vivo storage, but are programmed to release the biologically active monomers on demand.
A key step towards meeting those goals involves learning how to engineer globular proteins to fold switch and exploit one of the folds for assembly. The CI2 case makes a remarkable proof of concept. Moreover, the emerging paradigm on protein fold switching suggests that our strategy is likely generalizable. Metamorphic proteins are a relatively recent discovery, but several examples are now available of proteins that alternate between folds42. Proteins specifically designed to switch folds have also been achieved44,45. Recent computational analysis estimates that up to 4% of the structural characterized proteins are actually metamorphic43. Moreover, the coupling between fold switching and assembly is widespread among naturally metamorphic proteins, and often key for their biological function43. Our work contributes to this new paradigm by shedding much needed light onto the structural determinants of fold switching. CI2 folds into a rare topology, unique to its family of protease inhibitors (Supplementary Fig. 3). This topology induces structural strain on the two protein termini to form the network of buried salt bridges that locks the functional loop in its active conformation (Fig. 2e)51. In contrast, the alternate fold represents the simplest Rossmann motif (bab-b), one that is considered structural ancestor of a large subclass of α/β parallel proteins40. We thus propose that proteins with highly specialized native architectures maintain the primordial fold from which their architecture evolutionary diverged in latent form. We know that those ancient folds can accommodate vast sequence spaces, and thus, it is reasonable to expect that such folds remain encoded as metastable, or latent conformations in highly divergent sequences.
Methods
Cloning, expression, and purification of CI2 variants
The amino-acid sequences of wild-type CI2 and engineered versions (mutations shown in bold) are:
Wild-type CI2: MDLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNIAEVPRVG
CI2eng: MDAKTEWPELVGKSLEEAKKALLQDKPEATIIVIPVGTIVTMEYRVDRVRIVVDKLDNIAEVPTVG
I59A-CI2eng: MDAKTEWPELVGKSLEEAKKALLQDKPEATIIVIPVGTIVTMEYRVDRVRIVVDKLDNAAEVPTVG
CI21–58:MDLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDN
All proteins were synthesized using gene optimization (Top Gene Technologies Inc.), cloned into the pBAT4 plasmid, and transformed in BL21-Gold(DE3) Escherichia coli-competent cells (Agilent Technologies). LB medium with 100 mg l−1 ampicillin was used to grow a cell culture at 37 °C to an OD600 of 1.2, at which time expression of the protein was induced with isopropyl β-d-1-thiogalactopyranoside at 100 mg l−1 overnight at 30 °C. Cells were harvested at 10,000 × g for 30 min, lysed by several freeze–thaw cycles, and centrifuged down at 60,000 × g for 60 min. Protein purification was performed by high-performance liquid chromatography with an anionic exchange column (HiTrap Q HP from GE Healthcare Life Sciences) in 20 mM sodium borate buffer at pH 8.5 and a gradient of 0–1 M NaCl. Fractions containing the protein were pooled, dialyzed in the same buffer to remove salts, and injected onto a reverse phase column (Proto 300 C4 column from Western Analytical products) for a second purification step. Fractions containing >99% pure CI2 variant were pooled, confirmed by mass spectrometry, and freeze dried.
Mutational strategy to promote the fold switch
The mutational strategy aimed to: (1) destabilize the hyper-stable native fold of CI2; (2) accelerate the unfolding rate; (3) increase the propensity of the protein to form its native secondary structure elements; and (4) reshuffle the hydrophobic interactions to facilitate repacking on both conformations. A structural analysis of the CI2 native fold and sequence analysis of the family of CI2 structural homologs (Supplementary Fig. 3) led us to identify 10 target locations that were distributed over the entire amino-acid sequence, included residues in each of secondary structure elements, were susceptible to enhancement of secondary structure propensity by mutation, and/or were engaged in hydrophobic interactions determining the native protein core (interactions between the β-sheet and either the α-helix or the functional loop). Once the specific locations in the structure were identified, mutations were designed to increase the secondary structure propensity according to the semi-empirical propensity scales for β-sheet and α-helix as defined in ref. 52, and to reshuffle the hydrophobic packing of the native structure while: (1) keeping the overall solvent accessible surface area constant; (2) minimizing the production of cavities in the core; and (3) maintaining the overall hydrophobicity of the wild-type sequence. The final mutational strategy is summarized in Supplementary Table 2.
Equilibrium chemical and thermal denaturation experiments
Samples were prepared dissolving the lyophilized protein in 7 M GdmCl to eliminate any possible non-specific aggregate induced by the freeze-dry procedure, and then dialyzed extensively against 20 mM sodium borate at pH 8.5. For chemical denaturation experiments, protein samples at 50 μM were prepared in solutions of GdmCl at different concentrations in 20 mM sodium borate buffer at pH 8.5. The experiments were performed at 298 K, and the unfolding reaction was monitored by tryptophan fluorescence. The chemical denaturation experiments (Fig. 2g in main article) were fitted to a two-state unfolding transition that rendered the following parameters for wild-type CI2: Cm = 4.07 M and ΔG0 = 30.9 kJ mol−1; and for CI2eng: Cm = 1.28 M and ΔG0 = 10.9 kJ mol−1. For thermal denaturation experiments, protein samples at different concentrations were prepared in 20 mM sodium borate buffer at pH 8.5. Fluorescence experiments were performed collecting the total fluorescence emission after excitation at 280 nm in a Jobin Yvon Fluorolog-3 spectrofluorometer from Horiba. Far-UV CD experiments were performed measuring the molar ellipticity of the sample from 190 to 250 nm every 1 nm on a Chirascan CD spectrometer from Applied Photophysics.
Monomer recovery with C-peptide
The peptide corresponding to the C-terminal segment of CI2 (Acetylated-IAEVPRVG) was synthesized using F-moc chemistry and the purity confirmed by mass spectrometry. A 10 mM stock solution was prepared in 20 mM sodium borate buffer at pH 8.5. After preparation of the protein samples at 80 μM (oligomerizing conditions) or at 2 μM (monomeric conditions) and at different concentrations of the C-peptide, the mixtures were maintained for a few hours at 298 K for equilibration before the measurements. Monomer recovery was followed by analytical ultracentrifugation (using the conditions indicated below) or by fluorescence (using the conditions indicated above). The fluorescence signal was corrected for the effect of temperature on the tryptophan fluorescence measured in N-acetyl-tryptophanamide to permit direct comparison of the experiments performed at 298 and 310 K.
Kinetic folding–unfolding experiments
Kinetic measurements of the folding–unfolding relaxation of CI2 variants in response to changes in the concentration of chemical denaturant were performed at 298 K on a SX20-LED Stopped Flow fluorometer from Applied Photophysics. The lyophilized purified protein was dissolved in 7 M GdmCl and diluted to a final protein concentration of 10 μM in either a fixed low or fixed high final concentration of GdmCl. Unfolding experiments were performed by mixing the low GdmCl concentration sample with solutions of GdmCl at different concentrations (prepared in 20 mM sodium borate buffer at pH 8.5) at a 1:10 ratio. Refolding experiments were performed the same way but using the high GdmCl concentration protein sample. Fluorescence emission above 320 nm was collected with a long-pass filter after excitation at 280 nm. The relaxation at each condition (final concentration of GdmCl) was determined by averaging 10 individual kinetic traces that showed no signs of mixing artefacts. The resulting averaged traces were fitted to a single exponential function (unfolding), or to a single exponential plus a linear slope (refolding) to take into account the slow proline isomerization process of these proteins. The relaxation rate as a function of chemical denaturant (experiments in Fig. 1h in the main article) rendered the following parameters: for wild-type CI2: kf0 = 44 s−1, mf = −0.78 kJ mol−1 M−1 and ku0 = 1.9 × 10–4 s−1, mu = 0.51 kJ mol−1 M−1; and for CI2eng: kf0 = 25 s−1, mf = −0.89 kJ mol−1 M−1 and ku0 = 0.58 s−1, mu = 0.52 kJ mol−1 M−1.
Enzymatic activity measurements
The protease inhibitor activity of CI2 variants was determined using a colorimetric assay for the conversion of N-benzoyl-l-tyrosine ethyl ester (BTEE) to N-benzoyl-l-tyrosine catalyzed by the enzyme chymotrypsin. Assays in the absence and presence of CI2 were performed following the protocol indicated by Sigma53. Different concentrations of BTEE (from 10 to 1000 μM) were mixed with 53 mM CaCl2, 200 nM CI2 variant (if needed), and, finally, 53 nM chymotrypsin to a final volume of 3 ml in 50 mM Tris buffer at pH 7.8. After the addition of chymotrypsin, the sample was manually mixed and introduced in a Cary 100 bio UV–Visible spectrophotometer from Varian to follow the change in absorbance at 256 nm. The initial velocity of conversion is determined by fitting the change in absorbance during the first few seconds of the reaction to a straight line. Initial velocities obtained for every different concentration of substrate were fitted to the equation,
\[
{\mathbf{V}}_{0} = \frac{{{V}_{{\mathrm{max}}} {\mathbf{S}}}}{{K_m^{\mathrm{app}} + {\mathbf{S}}}},
\]
where V0 is a vector with the measured initial velocities, Vmax corresponds to the maximal velocity, S is a vector with the BTEE concentrations used in the assay, and \(K_{\mathrm{m}}^{{\mathrm{app}}}\) is the apparent Michaelis–Menten constant, which can be expressed as,
\[
K_{\mathrm{m}}^{{\mathrm{app}}} = K_{\mathrm{m}}\left( {1 + \frac{{\mathbf{I}}}{{K_{\mathrm{i}}}}} \right),
\]
where Km is the true Michaelis–Menten constant, I is the concentration of inhibitor, and Ki is the inhibitor’s disocciation constant.
Analytical size-exclusion chromatography
Protein samples at different concentrations were prepared in 7 M GdmCl and dialyzed against 20 mM sodium borate at pH 8.5 to eliminate potential non-specific aggregates produced by the freeze-dry procedure. For every run, 200 μl of sample were injected in a Superdex 200 Increase 10/300 GL size-exclusion column (from GE Healthcare). The chromatography run was performed using a flow of 0.5 ml/min of a buffer solution with 20 mM sodium borate at pH 8.5 to separate the species with different molecular mass.
Analytical ultracentrifugation
Sedimentation velocity (SV) measurements were performed at 298 K and 48,000 r.p.m. (184,000 × g) using an Optima XL-I analytical ultracentrifuge equipped with UV–VIS absorbance and Raleigh interference optics (from Beckman Coulter). Samples of CI2 variants at different final concentrations were prepared in 7 M GdmCl, dialyzed against 20 mM sodium borate buffer at pH 8.5, and filtered before the experiment. Differential sedimentation coefficient distributions c(s) were calculated via least-squares boundary modeling of SV data using SEDFIT54. From this analysis, the experimental sedimentation coefficients were corrected for solvent composition and temperature with the program SEDNTERP55 to obtain the corresponding standard s values, s20,w. The theoretical frictional ratio f/f0, a parameter related with the asymmetry of the different protein species, was also calculated using SEDNTERP. The s20,w values were correlated with theoretical s values for the cryo-EM 3D structures calculated using HYDROMIC56.
Size-exclusion coupled to multi-angle light scattering
Size-exclusion chromatography coupled to multi-angle laser light scattering measurements were carried out in a DAWN-EOS multi-angle light scattering photometer equipped with an Optilab rEX differential refractometer (from Wyatt Technology Corp) and a UV–VIS spectrophotometer SpectraSystem UV-2000 (from Thermo Scientific). The instrument is configured to collect data in parallel from the incoming sample flow eluting (at 0.5 ml min−1 at 298 K) from a coupled Superdex 200 10/300 GL size-exclusion column (from GE Healthcare). Samples of CI2 variants at 1 mM prepared in buffer 20 mM sodium borate at pH 8.5 as described previously were injected in the column (200 μl). A fraction of 200 μl from the size-exclusion chromatography that contained mostly dodecamer was also reinjected. The acquired raw data consisted of the scattering intensity at 14 scattering angles and the concentration (differential refractive index or absorbance at 280 nm). The average molecular masses for the species separated with the column were calculated from the ratio of scattering to concentration using the ASTRA software57. Bovine serum albumin (from Sigma-Aldrich) was used as standard to compute the calibration constant.
Differential scanning calorimetry
Freeze-dried CI2 variants were dissolved in 7 M GdmCl and then exhaustively dialyzed against 20 mM sodium borate buffer at pH 8.5 to eliminate potential non-specific aggregates and allow the protein to slowly requilibrate. DSC experiments were carried out on a MicroCal VP-Capillary DSC (from Malvern Instruments). A typical calorimetric run involved a number of buffer–buffer baselines to ensure proper equilibration of the calorimeter followed by runs with the proteins under study with intervening buffer–buffer baselines, at a scan rate of 200 K h−1. Several experiments were performed with protein concentrations in the 6–600 μM range. For wild-type CI2, absolute heat capacities were calculated from the protein concentration dependence of the apparent heat capacities58. The resulting profile was analyzed according to the two-state equilibrium model. The theoretical prediction for the absolute heat capacity of the native state was also calculated. For the other CI2 variants, the absolute molar heat capacity values at each protein concentration as a function of temperature were calculated using subroutines provided by the Microcal software.
X-ray crystallography
Samples of wild-type CI2 were pooled and concentrated to 10 mg ml−1 in 20 mM sodium borate buffer at pH 8.5 prior to crystallization experiments. Crystallization screening was performed using the sitting drop vapor diffusion method on a nano-dispensing robot HoneyBee (from Isogen) with commercially available crystallization screens (Molecular Dimensions Wizard Classic and Jena Bioscience Classic). Initial conditions were improved to grow final diffraction quality crystals at 293 K in 1.4 M ammonium sulfate with 100 mM Tris-HCl at pH 8.5 (condition a) or in 25% PEG3350 with 100 mM Tris-HCl at pH 8.5 and 200 mM lithium sulfate (condition b). Obtained crystals were cryoprotected with a solution containing 1 M sodium malonate (condition a) or 30% ethylene glycol (condition b) and flash cooled by plunging them into liquid nitrogen. Diffraction data were collected at 100 K at the Xaloc beamline of the ALBA synchrotron (Barcelona, Spain) and integrated and scaled using MOSFLM59 and AIMLESS60. Despite differences in crystallization conditions, both crystals belonged to the P622 space group with unit cell parameters of a = b = 68.77 and c = 50.56 Å (condition a) or a = b=68.55 and c=53.10 Å (condition b), diffracting at 1.65 or 1.50 Å, respectively. The Matthews value is 2.35 Å3/Da with a solvent content of 47.57% for condition a and 2.45 Å3/Da with a solvent content of 49.76% for condition b. The structures were determined by molecular replacement using MOLREP61, from the CCP4 software suite with the crystal structure of wild-type CI2 (PDB code 2CI241) as search probe. Initial rounds of refinement were carried out using REFMAC62, and final TLS refinement was done using PHENIX63. All model building, placement of side chains, and water addition were performed using COOT64.
Cryo-electron microscopy
For cryo-EM sample preparation, Quantifoil grids (R1.2/R1.3 300 mesh grids; ref. Q09684) were covered with a thin carbon layer (4 nm). Aliquots (5 µl) of a 1 mM sample of CI2eng were incubated with the grid (2–5 min), blotted, and plunged into a liquid ethane chamber. All operations were performed on a Leica CPC manual plunger. Images were acquired in a FEI Talos Arctica cryo-EM operated at 200 kV and equipped with a Falcon III detector, at a calibrated magnification of ×120,000 (0.85 Å px−1 sample resolution), and a dose rate of ~2.5 electrons Å−2. Exposures of 1.5 s were fractionated into 34 movie frames. A total of 830 movies were recorded and subjected to movie correction using MOTIONCORR65 and CTF correction with CTFFIND466. The EM suite Scipion v1.267 was used for the subsequent image processing. A total of 710,000 individual particles were selected from the aligned micrographs and extracted. Four rounds of image 2D classification were performed using free-pattern maximum-likelihood procedures (Relion 2D classification)68 ending with 115,000 high-quality particles. Representative 2D averages were used to generate several initial 3D models with the software EMAN v2.1269. The particles were subjected to 3D classification using Relion and 77,750 particles were selected to continue several rounds of classification. D6 symmetry was imposed on the most consistent volume and a 3D classification with all 77,750 particles was performed with D6 symmetry imposed. Particles were subjected to three more rounds of 3D classification with D6 symmetry, ending with 6200 high-quality particles, which were used for a final 3D volume refinement with D6 symmetry using Relion 3D auto-refine followed by a Relion post-processing step. The resolution was estimated with Fourier shell correlation using 0.143 correlation coefficient criteria69. Visualization of the 3D models and docking of the atomic structures into EM volumes was performed manually using USCF Chimera70.
Negative staining EM
Samples of CI2eng at a concentration of 1 mM were applied to glow-discharged carbon grids and stained with 2% (w/v) uranyl acetate. Micrographs were recorded in a JEOLJEM-1010 electron microscope, operated at 80 kV, with a TemCam F416 camera (from TVIPS GmbH) at 78,000 nominal magnification to a final 1.98 Å pixel−1 resolution. Individual particles were selected automatically from micrographs and extracted with the XMIPP software package71. Image classification was performed using free-pattern maximum-likelihood procedures. Three hundred and fifty-seven high-quality particles were selected to perform 2D analysis. The particles were processed by angular refinement techniques implemented in EMAN without any imposed symmetry.
Nuclear magnetic resonance
Samples of uniformly 15N-13C-labeled CI2eng were produced from bacterial culture using 13C6-d-glucose and 15NH4Cl (Spectra Stable Isotopes) as sole carbon and nitrogen sources, respectively. The isotopically labeled CI2eng was expressed and purified following the same protocol previously described for the unlabeled protein. NMR samples for assignment were prepared at 1 mM concentration of 15N-13C-labeled protein in 5% D2O/95% H2O at pH 7.0. NMR data were acquired at 293 K or 308 K on a Bruker Avance III 600 MHz spectrometer equipped with a triple-resonance triaxial gradient probe. The following experiments were acquired to perform the sequential backbone and side chain assignment: [1H-15N]HSQC, HNCO, CCONH, HCCONH, HNCACB, CBCA(CO)NH, and HBHACONH. All NMR experiments were processed with NMRPipe72 and analyzed with PIPP73 and Sparky74. In first instance, sequential assignment of the monomeric CI2eng signals was carried out using a standard set of multidimensional heteronuclear triple-resonance NMR experiments (CCONH, HCCONH, and HBHACONH), leading to complete backbone resonance assignments excluding the four existing prolines. Once the assignment of the monomer signals was completed, the remaining signals were tentatively identified as corresponding to the assembled species. The identification of the assembly signals was subsequently confirmed from the changes in intensity relative to the monomer signals observed in HSQC experiments performed at various protein concentrations to alter the monomer-assembly equilibrium (see Supplementary Fig. 12). The changes in relative intensities were compared with independent data of the monomer assembly obtained by size-exclusion chromatography and analytical ultracentrifugation (Fig. 3a, b, Supplementary Figs. 6 and 7)). Once unambiguously identified as assembly signals, the extra cross-peaks were assigned sequentially using the full suite of 3D experiments and following the same strategy used for the native monomer.
MD simulations
Structural models of the CI2 monomer with either the C-terminal or the N-terminal strands removed from the structure were generated starting from the 2CI2.PDB file. The control structure with the open N terminus (with residues N2 to G12 unraveled) and the target structure with the open C terminus (with residues L56 to G66 unraveled) were generated using MODELLER. Missing atoms were added and the protonation state of all charged residues was determined using PDB2PQR v2.0 at pH 775. All atom MD simulations starting with both structures were performed using the CHARMM22* force field76 and the TIP3P water model, which is compatible with the CHARMM force field in Gromacs 5.0. The protein was introduced in an octahedral box that was subsequently filled with water molecules. The entire system was neutralized to achieve a net charge of zero and energy minimized to reach a tolerance of 1000.0 kJ mol−1 nm−1 using the steepest descent algorithm. All bonds were constrained using LINCS. Particle Mesh Ewald was used for long-range electrostatics with periodic boundary conditions. A modified Berendsen thermostat was used for the temperature coupling of the system. The time step used in the simulations was 2 fs. The system was subjected to NVT (constant number of particles, volume and temperature) equilibration for 100 ps with the position of the protein restrained, followed by NPT (constant number of particles, pressure and temperature) equilibration for another 100 ps. Finally, three 1-μs-long trajectories were produced in the NPT ensemble for each starting structure. RMSD was calculated with g_rms, using the Cα atoms of the residues not involved in the unraveling transition (residues 13 to 66 for the open N terminus simulation and residues 2 to 55 for the open C terminus simulation).
Atomic-resolution structural model of the assembly
The structural model for the fold-switched monomer obtained from the MD simulations (see previous section) was fitted into the density corresponding to a monomer in the 3D cryo-EM volume using USCF Chimera70. The monomer density was generated by segmentation of the density for the whole particle (double hexameric ring). Final fitting refinement of the monomer structure into the electron density was done using the RosettaCommons software with the relax in electron density protocol developed by DiMaio et al. 77. The talaris2014 energy function was used to score the structure and fitting to the electron density. The best-fitted monomer model generated in the previous step was aligned in the dodecamer density and used to generate the 12 monomers of the entire particle using the relax in density protocol and non-crystallographic 2_6 symmetry78. The symmetry definition file (generated via de make symmdef file.pl script) was modified to allow cartesian and angular rigid body orientations of the monomers during dodecamer fitting. The protocol involves setting up the symmetry, optimizing the symmetric packing of rotamers (allowing extra chi rotamer sampling), symmetric energy minimization, and fitting into the electron density. The same energy function (talaris2014) was used in this step and several thousand structures were generated with different weights for the electron density. The lowest scoring energy structure was chosen as atomic-resolution structural model of the toroidal dodecameric assembly.
Reporting summary
Further information on research design is available in the Nature Research Reporting Summary linked to this article.
Supplementary Materials
References
- JA Marsh, SA Teichmann. Structure, dynamics, assembly, and evolution of protein complexes. Annu. Rev. Biochem., 2015. [DOI | PubMed]
- A Ramanathan, A Savol, V Burger, CS Chennubhotla, PK Agarwal. Protein conformational populations and functionally relevant substates. Acc. Chem. Res., 2014. [DOI | PubMed]
- JM Matthews, M Sunde. Dimers, oligomers, everywhere. Adv. Exp. Med. Biol., 2012. [DOI | PubMed]
- ED Levy, JB Pereira-Leal, C Chothia, SA Teichmann. 3D complex: a structural classification of protein complexes. PLoS Comput. Biol., 2006. [DOI | PubMed]
- Q Luo, C Hou, Y Bai, R Wang, J Liu. Protein assembly: versatile approaches to construct highly ordered nanostructures. Chem. Rev., 2016. [DOI | PubMed]
- BJ Pieters, MB van Eldijk, RJ Nolte, J Mecinovic. Natural supramolecular protein assemblies. Chem. Soc. Rev., 2016. [DOI | PubMed]
- J Liu. A seven-helix coiled coil. Proc. Natl Acad. Sci. USA, 2006. [DOI | PubMed]
- YT Lai, D Cascio, TO Yeates. Structure of a 16-nm cage designed by using protein oligomers. Science, 2012. [DOI | PubMed]
- A Sciore. Flexible, symmetry-directed approach to assembling protein cages. Proc. Natl Acad. Sci. USA, 2016. [DOI | PubMed]
- YT Lai. Designing and defining dynamic protein cage nanoassemblies in solution. Sci. Adv., 2016. [DOI | PubMed]
- ED Levy, S Teichmann. Structural, evolutionary, and assembly principles of protein oligomerization. Prog. Mol. Biol. Transl. Sci., 2013. [DOI | PubMed]
- J Luo, Z Liu, Y Guo, M Li. A structural dissection of large protein–protein crystal packing contacts. Sci. Rep., 2015. [DOI | PubMed]
- D Grueninger. Designed protein–protein association. Science, 2008. [DOI | PubMed]
- PB Stranges, M Machius, MJ Miley, A Tripathy, B Kuhlman. Computational design of a symmetric homodimer using beta-strand assembly. Proc. Natl Acad. Sci. USA, 2011. [DOI | PubMed]
- Y Hsia. Design of a hyperstable 60-subunit protein icosahedron. Nature, 2016. [DOI | PubMed]
- NP King. Accurate design of co-assembling multi-component protein nanomaterials. Nature, 2014. [DOI | PubMed]
- JB Bale. Accurate design of megadalton-scale two-component icosahedral protein complexes. Science, 2016. [DOI | PubMed]
- J Votteler. Designed proteins induce the formation of nanocage-containing extracellular vesicles. Nature, 2016. [DOI | PubMed]
- Y Bai, Q Luo, J Liu. Protein self-assembly via supramolecular strategies. Chem. Soc. Rev., 2016. [DOI | PubMed]
- IW Hamley. Protein assemblies: nature-inspired and designed nanostructures. Biomacromolecules, 2019. [DOI | PubMed]
- JD Brodin. Metal-directed, chemically tunable assembly of one-, two- and three-dimensional crystalline protein arrays. Nat. Chem., 2012. [DOI | PubMed]
- EN Salgado. Metal templated design of protein interfaces. Proc. Natl Acad. Sci. USA, 2010. [DOI | PubMed]
- JC Carlson. Chemically controlled self-assembly of protein nanorings. J. Am. Chem. Soc., 2006. [DOI | PubMed]
- A Medina-Morales, A Perez, JD Brodin, FA Tezcan. In vitro and cellular self-assembly of a Zn-binding protein cryptand via templated disulfide bonds. J. Am. Chem. Soc., 2013. [DOI | PubMed]
- Y Bai. Highly ordered protein nanorings designed by accurate control of glutathione S-transferase self-assembly. J. Am. Chem. Soc., 2013. [DOI | PubMed]
- JD Brodin, JR Carr, PA Sontz, FA Tezcan. Exceptionally stable, redox-active supramolecular protein assemblies with emergent properties. Proc. Natl Acad. Sci. USA, 2014. [DOI | PubMed]
- DJ Huard, KM Kane, FA Tezcan. Re-engineering protein interfaces yields copper-inducible ferritin cage assembly. Nat. Chem. Biol., 2013. [DOI | PubMed]
- Y Suzuki. Self-assembly of coherently dynamic, auxetic, two-dimensional protein crystals. Nature, 2016. [DOI | PubMed]
- LA Churchfield, A Medina-Morales, JD Brodin, A Perez, FA Tezcan. De novo design of an allosteric metalloprotein assembly with strained disulfide bonds. J. Am. Chem. Soc., 2016. [DOI | PubMed]
- LA Churchfield, RG Alberstein, LM Williamson, FA Tezcan. Determining the structural and energetic basis of allostery in a de novo designed metalloprotein assembly. J. Am. Chem. Soc., 2018. [DOI | PubMed]
- AG Murzin. Biochemistry. Metamorphic proteins. Science, 2008. [DOI | PubMed]
- PN Bryan, J Orban. Proteins that switch folds. Curr. Opin. Struct. Biol., 2010. [DOI | PubMed]
- AF Dishman, BF Volkman. Unfolding the mysteries of protein metamorphosis. ACS Chem. Biol., 2018. [DOI | PubMed]
- DM Mitrea, RW Kriwacki. Regulated unfolding of proteins in signaling. FEBS Lett., 2013. [DOI | PubMed]
- YG Chang. Circadian rhythms. A protein fold switch joins the circadian oscillator to clock output in cyanobacteria. Science, 2015. [DOI | PubMed]
- RL Tuinstra. Interconversion between two unrelated protein folds in the lymphotactin native state. Proc. Natl Acad. Sci. USA, 2008. [DOI | PubMed]
- JH Ha, SN Loh. Protein conformational switches: from nature to design. Chemistry, 2012. [DOI | PubMed]
- JH Ha, JM Karchin, N Walker-Kopp, CA Castaneda, SN Loh. Engineered domain swapping as an on/off switch for protein function. Chem. Biol., 2015. [DOI | PubMed]
- SE Jackson, AR Fersht. Folding of chymotrypsin inhibitor 2. 1. Evidence for a two-state transition. Biochemistry, 1991. [DOI | PubMed]
- AV Efimov. Structural trees for protein superfamilies. Proteins, 1997. [DOI | PubMed]
- CA McPhalen, MN James. Crystal and molecular structure of the serine proteinase inhibitor CI-2 from barley seeds. Biochemistry, 1987. [DOI | PubMed]
- P Kulkarni. Structural metamorphism and polymorphism in proteins on the brink of thermodynamic stability. Prot. Sci., 2018. [DOI]
- Lauren L. Porter, Loren L. Looger. Extant fold-switching proteins are widespread. Proceedings of the National Academy of Sciences, 2018. [DOI]
- XI Ambroggio, B Kuhlman. Computational design of a single amino acid sequence that can switch between two distinct protein folds. J. Am. Chem. Soc., 2006. [DOI | PubMed]
- PA Alexander, Y He, Y Chen, J Orban, PN Bryan. A minimal sequence code for switching protein structure and function. Proc. Natl Acad. Sci. USA, 2009. [DOI | PubMed]
- V Muñoz, LA Campos, M Sadqi. Limited cooperativity in protein folding. Curr. Opin. Struct. Biol., 2016. [DOI | PubMed]
- Y Shen. Consistent blind protein structure generation from NMR chemical shift data. Proc. Natl Acad. Sci. USA, 2008. [DOI | PubMed]
- M Thorolfsson. -Phenylalanine binding and domain organization in human phenylalanine hydroxylase: a differential scanning calorimetry study. Biochemistry, 2002. [DOI | PubMed]
- G Wider, K Wuthrich. NMR spectroscopy of large molecules and multimolecular assemblies in solution. Curr. Opin. Struct. Biol., 1999. [DOI | PubMed]
- D Hoersch, SH Roh, W Chiu, T Kortemme. Reprogramming an ATP-driven protein machine into a light-gated nanocage. Nat. Nanotechnol., 2013. [DOI | PubMed]
- ES Radisky, CJ Lu, G Kwan, DE Koshland. Role of the intramolecular hydrogen bond network in the inhibitory power of chymotrypsin inhibitor 2. Biochemistry, 2005. [DOI | PubMed]
- V Muñoz, L Serrano. Intrinsic secondary structure propensities of the amino acids, using statistical ϕ–ψ matrices: comparison with experimental scales. Proteins, 1994. [DOI | PubMed]
- 53.Rick, W., Bergmeyer, H. -U., Gawehn, K. & Lund P. & Williamson D. in Methods of Enzymatic Analysis (ed. Bergmeyer, H. -U.) (Academic Press, 1974).
- P Schuck, P Rossmanith. Determination of the sedimentation coefficient distribution by least-squares boundary modeling. Biopolymers, 2000. [DOI | PubMed]
- 55.Laue, T. M., Shah, B. D., Ridgeway, T. M. & Pelletier S. L. in Analytical Ultracentrifugation in Biochemistry and Polymer Science (eds Harding, S. E., Rowe A. J. & Horton J. C.) (The Royal Society of Chemistry, 1992).
- J Garcia de la Torre, O Llorca, JL Carrascosa, JM Valpuesta. HYDROMIC: prediction of hydrodynamic properties of rigid macromolecular structures obtained from electron microscopy images. Eur. Biophys. J., 2001. [DOI | PubMed]
- E Folta-Stogniew, KR Williams. Determination of molecular masses of proteins in solution: Implementation of an HPLC size exclusion chromatography and laser light scattering service in a core laboratory. J. Biomol. Tech., 1999. [PubMed]
- V Kholodenko, E Freire. A simple method to measure the absolute heat capacity of proteins. Anal. Biochem., 1999. [DOI | PubMed]
- TG Battye, L Kontogiannis, O Johnson, HR Powell, AG Leslie. iMOSFLM: a new graphical interface for diffraction-image processing with MOSFLM. Acta Crystallogr. D, 2011. [DOI | PubMed]
- PR Evans. An introduction to data reduction: space-group determination, scaling and intensity statistics. Acta Crystallogr. D., 2011. [DOI | PubMed]
- A Vagin, A Teplyakov. MOLREP: an automated program for molecular replacement. J. Appl. Crystallogr., 1997. [DOI]
- GN Murshudov, AA Vagin, EJ Dodson. Refinement of macromolecular structures by the maximum-likelihood method. Acta Crystallogr. D, 1997. [DOI | PubMed]
- Paul D. Adams, Pavel V. Afonine, Gábor Bunkóczi, Vincent B. Chen, Ian W. Davis, Nathaniel Echols, Jeffrey J. Headd, Li-Wei Hung, Gary J. Kapral, Ralf W. Grosse-Kunstleve, Airlie J. McCoy, Nigel W. Moriarty, Robert Oeffner, Randy J. Read, David C. Richardson, Jane S. Richardson, Thomas C. Terwilliger, Peter H. Zwart. PHENIX: a comprehensive Python-based system for macromolecular structure solution. Acta Crystallographica Section D Biological Crystallography, 2010. [DOI | PubMed]
- P Emsley, B Lohkamp, WG Scott, K Cowtan. Features and development of Coot. Acta Crystallogr D, 2010. [DOI | PubMed]
- X Li. Electron counting and beam-induced motion correction enable near-atomic-resolution single-particle cryo-EM. Nat. Methods, 2013. [DOI | PubMed]
- A Rohou, N Grigorieff. CTFFIND4: Fast and accurate defocus estimation from electron micrographs. J. Struct. Biol., 2015. [DOI | PubMed]
- JM De la Rosa-Trevin. Scipion: a software framework toward integration, reproducibility and validation in 3D electron microscopy. J. Struct. Biol., 2016. [DOI | PubMed]
- D Kimanius, BO Forsberg, SH Scheres, E Lindahl. Accelerated cryo-EM structure determination with parallelisation using GPUs in RELION-2. Elife, 2016. [DOI | PubMed]
- SH Scheres. RELION: implementation of a Bayesian approach to cryo-EM structure determination. J. Struct. Biol., 2012. [DOI | PubMed]
- EF Pettersen. UCSF Chimera—a visualization system for exploratory research and analysis. J. Comput. Chem., 2004. [DOI | PubMed]
- JM De la Rosa-Trevin. Xmipp 3.0: an improved software suite for image processing in electron microscopy. J. Struct. Biol., 2013. [DOI | PubMed]
- F Delaglio. NMRPipe: a multidimensional spectral processing system based on UNIX pipes. J. Biomol. NMR, 1995. [DOI | PubMed]
- DS Garrett, R Powers, AM Gronenborn, GM Clore. A common sense approach to peak picking in two-, three-, and four-dimensional spectra using automatic computer analysis of contour diagrams. J. Magn. Res., 2011. [DOI]
- 74.Goddard, T. D. & Kneller, D. G. SPARKY 3 (University of California, San Francisco).
- TJ Dolinsky, JE Nielsen, JA McCammon, NA Baker. PDB2PQR: an automated pipeline for the setup of Poisson–Boltzmann electrostatics calculations. Nucleic Acids Res., 2004. [DOI | PubMed]
- S Piana, K Lindorff-Larsen, DE Shaw. How robust are protein folding simulations with respect to force field parameterization?. Biophys. J., 2011. [DOI | PubMed]
- F DiMaio. Atomic-accuracy models from 4.5-A cryo-electron microscopy data with density-guided iterative local refinement. Nat. Methods, 2015. [DOI | PubMed]
- F DiMaio, A Leaver-Fay, P Bradley, D Baker, I Andre. Modeling symmetric macromolecular structures in Rosetta3. PLoS ONE, 2011. [DOI | PubMed]
