Simplified cloning and isolation of peptides from “sandwiched” SUMO-peptide-intein fusion proteins
Abstract
Background:
Some peptides are targets for degradation when heterologously expressed as fusion proteins in E. coli, which can limit yields after isolation and purification. We recently reported that peptide degradation may be prevented by production of a “sandwiched” SUMO-peptide-intein (SPI) fusion protein, which protects the target peptide sequence from truncation and improves yield. This initial system required cloning with two commercially available vectors. It used an N-terminal polyhistidine tagged small ubiquitin-like modifier (SUMO) protein and a C-terminal engineered Mycobacterium xenopii DNA Gyrase A intein with an inserted chitin binding domain (CBD) to create “sandwiched” fusion proteins of the form: His6-SUMO-peptide-intein-CBD. However, the major drawback of this previously reported fusion protein “sandwich” approach is the increased time and number of steps required to complete the cloning and isolation procedures, relative to the simple procedures to produce recombinant peptides in E. coli from a single (non-“sandwiched”) fusion protein system.
Results:
In this work we generate the plasmid pSPIH6, which improves upon the previous system by encoding both the SUMO and intein proteins and allows facile construction of a SPI protein in a single cloning step. Additionally, the Mxe GyrA intein encoded in pSPIH6 contains a C-terminal polyhistidine tag, resulting in SPI fusion proteins of the form: His6-SUMO-peptide-intein-CBD-His6. The dual polyhistidine tags greatly simplify isolation procedures compared to the original SPI system, which we have here demonstrated with two linear bacteriocin peptides: leucocin A and lactococcin A. The yields obtained for both peptides after purification were also improved compared to the previous SPI system as a result of this streamlined protocol.
Conclusions:
This modified SPI system and its simplified cloning and purification procedures described here may be generally useful as a heterologous E. coli expression system to obtain pure peptides in high yield, especially when degradation of the target peptide is an issue.
Supplementary Information:
The online version contains supplementary material available at 10.1186/s12896-023-00779-5.
Article type: Research Article
Keywords: Peptide, Bacteriocin, Heterologous expression, Small ubiquitin-like modifier (SUMO), Intein, Protein purification, Fusion protein
Affiliations: grid.17089.370000 0001 2190 316XDepartment of Chemistry, University of Alberta, Edmonton, AB T6G 2G2 Canada
License: © The Author(s) 2023 CC BY 4.0 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
Article links: DOI: 10.1186/s12896-023-00779-5 | PubMed: 37020212 | PMC: PMC10074672
Relevance: Relevant: mentioned in keywords or abstract
Full text: PDF (1.8 MB)
Background
Peptides are a class of biomolecules with established importance in industries including agriculture [ref. 1], pharmaceuticals [ref. 2], food [ref. 3], and cosmetics [ref. 4]. While many peptides can be produced using solid phase peptide synthesis [ref. 5], ribosomally synthesized peptides may be produced for research or industrial purposes using bacterial fermentation, as this method is relatively economical, green, and scalable [ref. 6].
Some peptide natural products may be readily isolated from the original producer organism, while others may be expressed by the host in only tiny amounts or under conditions that cannot be easily replicated in the laboratory [ref. 7]. In these cases, heterologous expression in Escherichia coli may offer a solution. Recombinant peptide production can be achieved by construction of a fusion protein that contains an affinity tag to aid in isolation, as well as a protease cleavage site to allow for separation of the peptide from the fusion protein during isolation and purification [ref. 8].
Common fusion proteins used in heterologous expression include glutathione S-transferase, small ubiquitin-like modifier (SUMO), intein proteins, thioredoxin, and maltose binding protein [ref. 9]. SUMO, inteins, and thioredoxin require an additional affinity tag to be included in the construct for easy isolation using affinity purification. A polyhistidine sequence is usually the affinity tag of choice, as immobilized metal ion chromatography using a resin such as a nickel nitrilotriacetic acid (Ni-NTA) has a very high binding capacity [ref. 10, ref. 11]. Other possible affinity tags include a chitin-binding domain (CBD) or maltose binding protein. Possible proteases and associated recognition sequences that can be used in fusion proteins include tobacco etch virus protease, factor Xa protease, enterokinase, and thrombin [ref. 12]. However, use of protease recognition sequences may be nonspecific or leave behind extra residues on the peptide of interest after cleavage. Importantly, use of an N-terminal His6-SUMO fusion tag, followed by addition of its corresponding SUMO protease during the isolation process will leave behind no extra residues on the peptide of interest [ref. 13]. Use of a C-terminal intein fusion protein will also produce a scarless cleavage site on the peptide of interest [ref. 14].
Combinations of multiple fusion proteins and/or affinity tags have also been reported. This can be in the form of simple addition of a polyhistidine sequence to other affinity tags, which is useful because Ni-NTA agarose has a higher binding capacity than most other affinity chromatography resins [ref. 15–ref. 22]. Dual or tandem fusion protein tags have been used to increase solubility of a target protein or offer unique purification strategies [ref. 23–ref. 29]. Still, other fusion proteins have been constructed with one or more flanking fusion tags on both the N- and C- termini of a protein of interest, thereby creating a fusion protein “sandwich” around a target protein [ref. 30–ref. 33]. Notably, when the “sandwiching” fusion proteins surrounding a target protein sequence are an N-terminal SUMO protein and a C-terminal intein, cleavage of each fusion protein will leave behind no extra residues on the target protein sequence [ref. 34, ref. 35].
We recently reported the use of this dual SUMO and intein “sandwiched” expression system to protect peptides from degradation during heterologous expression in E. coli [ref. 36]. In that work, we initially expressed four different peptides as simple SUMO fusion proteins, and found that the final yield of each purified peptide was very low due to truncations in the peptide sequences incurred during expression. We then showed that expression of each of these peptides as “sandwiched” SUMO-peptide-intein (SPI) fusion proteins prevented degradation and significantly improved final yields of the four peptides. However, one of the main disadvantages of using this SPI system is the significant increase in time needed for the cloning and isolation procedures, compared to that needed to clone and isolate a non-“sandwiched” fusion protein [ref. 37].
We here describe an updated SPI fusion protein system with simplified cloning and isolation procedures. The plasmid pSPIH6 was constructed, and this vector enables single step cloning construction of a SPI fusion protein with NEBuilder® HiFi DNA Assembly, which is based on the principles of Gibson assembly. The constructed SPI protein leaves behind no extra residues on the target peptide sequence after removal of the two fusion protein tags. The intein encoded in pSPIH6 (Mxe GyrA intein) includes an additional C-terminal polyhistidine tag to allow for a simplified purification process for any target peptide. The described isolation procedure has fewer steps, does not require chitin resin, and produces SPI fusion proteins of the form: His6-SUMO-peptide-intein-CBD-His6. Protein precipitation during intein cleavage was also addressed using a screen for buffer additives to prevent aggregation and insolubility. We used this simplified SPI system to clone, express, and purify the linear bacteriocin peptides leucocin A and lactococcin A (Table 1), which were previously shown to be truncated when expressed as simple SUMO fusion proteins [ref. 36]. The peptides were each purified and obtained in increased yield compared to the originally reported SPI system, likely due to the lower number of purification steps required. This updated and simplified SPI fusion system may be generally useful as a first choice of expression system for peptides and proteins (not just those that undergo degradation) as its cloning and isolation procedures are nearly the same number of steps as those for single fusion proteins.
Table 1: Comparison of peptide sequences used in this study
| Peptide | Amino acid sequence | Molecular weight (g/mol) | Number of residues |
|---|---|---|---|
| LeuA | KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW | 3929.8 | 37 |
| LcnA | KLTFIQSTAAGDLYYNTNTHKYVYQQTQNAFGAAANTIVNGWMGGAAGGFGLHH | 5774.8 | 54 |
Results
While it has been previously shown that the SPI system can significantly improve yields of purified peptides that undergo degradation during heterologous expression in E. coli, a major drawback of using the originally reported SPI system is the high number of steps and time required for construction of the expression vector (Fig. 1A) and for the purification process (Fig. 2A). To simplify the SPI cloning process, a single E. coli expression vector containing both the His6-SUMO and intein-CBD-His6 genes was constructed based on the pTXB1 vector backbone (Supplementary Fig. 1). The intein-CBD gene was PCR amplified from pTXB1 using a forward primer that included the upstream SapI restriction site, and a reverse primer that included an additional C-terminal polyhistidine tag DNA prior to the stop codon, and the PstI restriction site immediately following the stop codon. Digestion of pTXB1 and the PCR product with PstI and SapI followed by ligation generated the vector pTXIH6, which is identical to pTXB1 except that the encoded intein contains an extra C-terminal polyhistidine tag. Next, the His6-SUMO gene encoded in a previously constructed pET-SUMO-LeuA vector was amplified using primers that included specific complementary tail sequences for insertion into a NdeI and SapI digested pTXIH6 vector using NEBuilder® HiFi DNA Assembly. The reverse primer also included a PacI restriction site directly following the final glycine codon of the SUMO gene. Insertion of the His6-SUMO gene into NdeI and SapI digested pTXIH6 yielded the final construct pSPIH6, which encodes a His6-SUMO gene followed by an intein-CBD-His6 gene, with these two fusion protein coding sequences being separated by a unique PacI restriction site (Fig. 1B).


The PacI site in pSPIH6 allows for single step, seamless insertion of any target peptide gene between the last glycine codon of the His6-SUMO gene and the first cysteine codon (catalytic cysteine) of the intein-CBD-His6 gene. Two bacteriocin peptide genes, leucocin A (LeuA) and lactococcin A (LcnA), were each cloned into pSPHI6 (Fig. 1C). This was achieved by PCR amplification of the target peptide gene using primers that include complementary tail sequences to pSPIH6 on either side of the PacI restriction site. NEBuilder® HiFi DNA Assembly uses a DNA polymerase with both 5’ and 3’ exonuclease activity, allowing for abolition of the PacI restriction site and seamless, in-frame insertion of the peptide gene between the two flanking fusion protein genes.
Both LcnA and LeuA SPI fusion proteins were overexpressed in E. coli BL21(DE3) using isopropyl β-D-1-thiogalactopyranoside (IPTG) to induce SPI gene expression under the control of a T7 promoter. LcnA was induced at a lower temperature (15 °C overnight) because the final residue preceding the intein’s catalytic cysteine is a histidine, which can lead to premature intein hydrolysis during expression at 37 °C, as previously described [ref. 36] and predicted [ref. 38].
In addition to simplifying the cloning process for construction of SPI fusion proteins, the isolation and purification procedures were also simplified as a result of the extra C-terminal polyhistidine tag on the intein-CBD fusion protein (Fig. 2B). One issue encountered with both the LeuA and LcnA isolation processes was protein precipitation during the intein cleavage step. To address this issue, a screen of various buffer additives was performed on the LcnA SPI fusion protein to identify intein cleavage conditions that prevented precipitation (Supplementary Fig. 2A). Samples were gently rotated for 72 h at 4 °C, centrifuged to pellet any insoluble protein, and then SDS-PAGE was performed on the soluble fraction. Interestingly, the conditions that prevented protein precipitation were with no thiol added (no intein cleavage and SPI fusion protein kept intact), addition of 1% (v/v) of the non-ionic detergent IGEPAL® CA-630, and addition of 500 mM arginine hydrochloride. All other conditions displayed visual precipitation and SDS-PAGE of the soluble fraction after centrifugation showed disappearance of the SUMO-LcnA band. The identity of the precipitate was found to be SUMO-LcnA by SDS-PAGE of the resuspended insoluble precipitate (Supplementary Fig. 2B). An additional screen of lower concentrations of arginine hydrochloride and IGEPAL® CA-630, as well as combinations of these two additives showed that 250 mM arginine hydrochloride and 0.01% IGEPAL® CA-630 together were able to prevent protein precipitation during intein cleavage (Supplementary Fig. 2C). LeuA and LcnA were both finally purified under these conditions (Figs. 3 and 4), resulting in improved pure peptide yields compared to the originally reported SPI system (Table 2), and were active in an antimicrobial activity assay against Lactococcus lactis subsp. lactis IL1403 (data not shown).


Table 2: Comparison of yields of peptides after purification with SUMO and SPI systems
| Peptide | Purified peptide yield as SUMO fusion protein (mg)* | Purified peptide yield from original SPI system (mg)* | Purified peptide yield from simplified SPI system (mg) |
|---|---|---|---|
| LeuA | 0.1 | 1.7 | 1.9 |
| LcnA | < 0.1 mg | 0.7 | 3.0 |
*Values previously reported [ref. 36]
Discussion
Degradation of peptides heterologously expressed as fusion proteins in E. coli can be a major challenge. Optimization of expression conditions to suppress or minimize degradation is extremely time consuming, and it is difficult to predict whether it will improve results. We previously showed that expression of a “sandwiched” fusion protein of the form His6-SUMO-peptide-intein-CBD in E. coli can protect peptides against degradation and result in improved yields [ref. 36]. Here, the SPI system was optimized by creating a single expression vector, pSPIH6 (Addgene plasmid #190676), that encodes both fusion proteins and allows for construction of a SPI fusion protein in a single cloning step. This universal plasmid is a significantly cheaper and faster option to construct a SPI fusion protein than beginning from commercially available pET-SUMO and pTXB1 vectors. pSPIH6 allows for insertion of any peptide gene sequence, and results in scarless cleavage sites and no extra residues left behind on the target peptide sequence after purification. This is particularly important for peptides, as any additional residues may impact structure and function of these small proteins.
The addition of a C-terminal polyhistidine tag to the Mxe GyrA intein has been reported previously [ref. 39] and allows the use of Ni-NTA affinity chromatography during the isolation process, rather than chitin affinity columns. Immobilized metal ion affinity chromatography is preferential because of the resin’s higher binding capacity compared to other types of affinity chromatography [ref. 11]. In this work, addition of the extra C-terminal polyhistidine tag on the SPI construct (His6-SUMO-peptide-intein-CBD-His6) also greatly simplified the isolation procedure, and the fewer number of steps led to an improved yield compared to the originally reported SPI system for both LeuA and LcnA. Several conditions in the isolation process were also modified based on a literature method [ref. 39]. The Tris lysis buffer was changed to a phosphate buffer to prevent reaction of Tris with thioester-containing proteins [ref. 40]. Intein cleavage conditions were modified from 100 mM D,L-dithiothreitol (DTT) to 100 mM 2-mercaptoethanol (βME) with 10 mM tris(2-carboxyethyl)phosphine (TCEP) because intein cleavage was faster with βME than DTT (data not shown). This may be due to increased stability of βME during the overnight cleavage reaction compared to DTT. Ethylenediaminetetraacetic acid (EDTA) was also added to the intein cleavage reaction to chelate any Ni2+ eluted from the Ni-NTA column and prevent oxidation of βME.
Intein cleavage conditions required optimization and screening of buffer additives to prevent precipitation of the SUMO-peptide fusion proteins [ref. 41]. Addition of 250 mM arginine and 0.01% (v/v) IGEPAL® CA-630 were found to prevent precipitation. Lower concentrations of arginine without detergent present did not prevent precipitation (Supplementary Fig. 2A). The subsequent dialysis step is extremely important to remove arginine, EDTA, βME, and TCEP, which each may interfere with the SUMO protease and/or subsequent Ni-NTA affinity chromatography. Despite the low concentration, 0.01% (v/v) IGEPAL® CA-630 is still above the critical micellar concentration of this detergent (0.083 mM), which may be why it is still sufficient to suppress protein precipitation. As dialysis does not remove the micellar detergent, it was important to use as small a concentration as possible to prevent issues with high performance liquid chromatography (HPLC) purification.
While it cannot be predicted if the combination of arginine and IGEPAL® CA-630 will work to keep all SUMO-peptide fusion proteins soluble during intein cleavage of SPI fusion proteins, a general buffer additive screening method was implemented here that could be easily repeated for other SPI fusion proteins. It is possible that in other SPI constructs the SUMO-peptide fusion protein may remain fully soluble during intein cleavage and buffer additives are not required. In these cases, it would be better to perform intein cleavage without detergent present to simplify HPLC purification.
There are several considerations when choosing to use the SPI system for peptide expression and purification. For efficient SUMO cleavage by the SUMO protease, the first residue of the peptide following the diglycine cleavage site of the SUMO tag cannot be a proline. Likewise, the Mxe GyrA intein used in this SPI system has preferences for certain residues preceding the catalytic cysteine. Most residues are tolerated, though some such as histidine are predicted to lead to premature intein hydrolysis [ref. 38]. LcnA is one such peptide sequence that terminates in a histidine residue, but it is possible to minimize premature intein cleavage with lower temperature induction conditions. Still, other residues are predicted to lead to slower intein cleavage, though these are predictions and must be tested on a case by case basis. It may also be possible to swap the intein included in the SPI system to other inteins with improved cleavage parameters, solubility, or residue preferences. Finally, the use of a thiol reducing agent to cleave the intein from the SPI fusion protein reduces any disulfide bonds in the peptide, and so a refolding step may be required to reform native disulfides.
While this work addresses the degradation of peptides during E. coli heterologous expression by protecting the peptide sequence between cleavable SUMO and intein proteins, recent reports have shown the use of similar traceless SUMO and intein fusion protein “sandwiches” for other purposes. Osunsade et al. reported a SUMO and intein “sandwich” to successfully produce C-terminal domains of histone proteins, which are highly positively charged and are often degraded during heterologous expression [ref. 35]. Raducanu et al. developed an expression system with SUMO and intein sequences flanking a protein of interest for scarless cleavage, but with additional thioredoxin proteins fused to both the SUMO and intein fusion proteins to improve solubility [ref. 34]. The “sandwiching” expression strategy using an N-terminal SUMO protein and a C-terminal intein, which each allow for traceless removal of the fusion protein and no extra residues left behind on a target protein or peptide sequence, may become a general fusion protein expression strategy and be especially useful to produce proteins or peptides that are prone to degradation.
Conclusions
While previously reported SPI expression systems required time-consuming cloning and isolation procedures and would not be recommended for use unless degradation of the target peptide sequence was occurring, the simplicity of the updated SPI system described here may make it an attractive first choice expression system for many target peptides or proteins, even when degradation is not an issue.
Materials and methods
General method information
Commercially available chemical and biological reagents were purchased from Sigma-Aldrich Canada, Bio-Rad Laboratories, Chem-Impex International Inc., or Thermo Fisher Scientific, and used without further purification unless otherwise stated. HPLC grade acetonitrile was used without further purification. Deionized water was obtained from a Milli-Q reagent water filtration system (Millipore Co., Milford, MA). Semi-preparative scale HPLC was performed on an Agilent chromatograph equipped with a 1260 Infinity II quaternary pump, a 1260 Infinity II diode array detector, a 1260 Infinity II fraction collector, and a 1260 Infinity II manual injector fitted with a 500 µL sample loop. The column used for HPLC was a Vydac 219TP Diphenyl, 5 µ, 10 × 250 mm. HPLC solvents were filtered through a Millipore filtration system under vacuum prior to use. Mass spectra were recorded on a Perspective Biosystems Voyager™ Elite matrix-assisted laser desorption ionization time of flight mass spectrometry (MALDI-TOF MS) using sinapinic acid as a matrix, and data was analyzed with Agilent Mass Hunter Qualitative Analysis software Package (version B.03.01 SP3). The molecular weight marker used in SDS-PAGE was PageRuler Prestained Protein Ladder, 10–180 kDa (Thermo Scientific). E. coli plasmids were purified using GeneJET Plasmid Miniprep Kit (Thermo Scientific), and linearized plasmids and PCR products were purified using GeneJET PCR Purification Kit (Thermo Scientific). PCR reactions were completed using Phusion® High-Fidelity DNA Polymerase (New England BioLabs), and all restriction enzymes were obtained from New England BioLabs and reactions were performed according to manufacturer recommendations. Supplementary methods including DNA primer sequences, DNA and protein sequences, HPLC chromatograms, and MALDI-TOF MS spectra can be found in the supplementary information file.
Construction of pTXIH6 and pSPIH6 plasmids
From pTXB1 the Mxe GyrA intein was amplified using primers Int-F and Int-R, which added a C-terminal polyhistidine (His6) tag to the protein sequence, as well as 5’ SapI and 3’ PstI restriction sites in the PCR product. The PCR product was purified and then the pTXB1 vector (New England BioLabs) and the PCR product were each doubly digested with SapI and PstI. The linear DNA products were each purified, and then the digested PCR product was inserted into the linearized pTXB1 plasmid using T4 DNA Ligase. NEB® 10-beta Competent E. coli were then transformed with the ligation mixture, and transformed cells were plated out on Difco™ Luria Broth (LB) media plates (10 g of tryptone, 5 g of yeast extract, 10 g of NaCl) with ampicillin added (100 µg/mL) as selective pressure. Plates were grown overnight at 37 °C, and then colony PCR was performed with primers Col-Int-F and Col-Int-R to screen for transformants containing the His-tagged intein insert. Potential positive transformant pTXIH6 colonies were then grown in 5 mL of LB media overnight, purified, and sequenced with Sanger sequencing using primers Int-seq-F-1, Int-seq-R-1, Int-seq-F-2, and Int-seq-R-2. Cells containing the correct His-tagged intein insert (pTXIH6) were stored as 20% glycerol stocks at -80 °C.
From pET-SUMO-LeuA, the His6-SUMO gene was amplified using primers SUMO-F and SUMO-R, which included specific tail sequences for insertion into NdeI and SapI digested pTXIH6 using NEBuilder® HiFi DNA Assembly. The PCR product was purified, and then pTXIH6 was digested with NdeI and SapI, followed by purification of the linearized plasmid. NEBuilder® HiFi DNA Assembly Master Mix was then used to insert the SUMO PCR product into the linearized pTXIH6 vector. NEB® 10-beta Competent E. coli were then transformed with the product mixture, and transformed cells were plated on LB media with ampicillin added (100 µg/mL) as selective pressure. Plates were grown overnight at 37 °C, and then colony PCR was performed with primers SUMO-Col-F and SUMO-Col-R to screen for transformants containing the SUMO gene. Potential positive transformant pSPIH6 colonies were then grown in 5 mL of LB media overnight, purified, and sequenced with Sanger sequencing using primers SUMO-Col-F and SUMO-Col-R. Cells containing the correct insert (pSPIH6) were stored as 20% glycerol stocks at -80 °C.
General method for cloning peptide genes into pSPIH6
pSPIH6 is available through Addgene (plasmid #190,676). LeuA and LcnA peptide genes were amplified from previously constructed pTXB1-SPI-LeuA and pTXB1-SPI-LcnA vectors [ref. 36] using primers that included specific tail sequences for insertion into a PacI digested pSPIH6 vector using NEBuilder® HiFi DNA Assembly (Supplementary Table 1). The primers used were LeuA-G-F and LeuA-G-R for LeuA, and LcnA-G-F and LcnA-G-R for LcnA. pSPIH6 was digested with PacI and the linearized vector and peptide gene PCR products were purified. PCR products were inserted into the PacI digested pSPIH6 using NEBuilder® HiFi DNA Assembly Master Mix. NEB® 10-beta Competent E. coli were then transformed with the product mixture, and transformed cells were plated on LB media with ampicillin added (100 µg/mL) as selective pressure. Plates were grown overnight at 37 °C, and then colony PCR was performed with universal primers SPI-col-F and SPI-col-R to screen for transformants containing the desired peptide gene inserted into pSPIH6. Potential positive transformant colonies were then grown in 5 mL of LB media overnight, purified, and sequenced with Sanger sequencing using universal primers TL-pTXB1-F and SUMO-Col-R. Cells containing the correct insert (pSPIH6-LeuA or pSPIH6-LcnA) were stored as 20% glycerol stocks at -80 °C, and then E. coli BL21(DE3) cells were transformed with the desired pSPIH6-peptide plasmids for protein production.
General SPI protein expression and isolation procedures
Frozen glycerol stocks of E. coli BL21(DE3) cells transformed with the appropriate pSPIH6-peptide vector were inoculated into 50 mL of sterile LB media with ampicillin added (100 µg/mL) as selective pressure. The cells were grown overnight at 37 °C with shaking at 225 rpm. The next day, 20 mL of the overnight culture was added to 500 mL of sterile LB media with ampicillin added, and cells were grown to an optical density (OD600) of 0.8 at 37 °C. Protein expression was then induced by addition of IPTG at final concentrations of 0.1 mM for induction at 15 °C overnight (~ 20 h), or 0.5 mM for induction at 37 °C for 4 h. If cells were to be induced at 15 °C, the flask was first cooled in an ice bath before adding IPTG. Cultures were shaken at 225 rpm during induction. Cells were then harvested by centrifugation (5,000 × g, 10 min, 4 °C) and the pellets were stored at -80 °C. In this study, cells expressing the LeuA SPI fusion protein were induced at 37 °C for 4 h, while cells expressing the LcnA SPI fusion protein were induced at 15 °C overnight.
The frozen cell pellet was resuspended (30 mL buffer/500 mL culture media) evenly in ice cold lysis buffer (50 mM NaH2PO4, 300 mM NaCl, 5 mM imidazole, pH 8.0) by vortexing. Cells were lysed by sonication while kept on ice (20% amplitude, constant pulse, 15 s on and 15 s off, 6 min total). DNase I (Thermo Scientific, 1 U) was added and the lysate kept on ice for 15 min with occasional inversion. The cellular debris was removed by centrifugation (20,000 × g, 30 min, 4 °C), and then pre-washed Ni-NTA resin (Qiagen) was added to the clarified supernatant (3 mL of resin/500 mL culture media) and the mixture was gently shaken for 1 h at 4 °C. This was then loaded onto a fritted column and the flow through collected at 4 °C. The resin was washed with 25 mL of lysis buffer containing 20 mM imidazole, and then the fusion protein was eluted in 5 mL fractions by sequential addition of elution buffer (50 mM NaH2PO4, 300 mM NaCl, pH 8.5) containing 40, 60, 80, 100, 200, and then 500 mM imidazole. Eluted fractions were analyzed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and/or MALDI-TOF MS and the samples containing the protein of interest were pooled together. The pooled fractions had 5 mM EDTA, 100 mM βME, 10 mM TCEP, 250 mM arginine hydrochloride, and 0.01% (v/v) IGEPAL® CA-630 added and were adjusted to pH 8.5 if needed. The sample was gently rotated overnight at 4 °C to cleave the intein. Intein cleavage completion was assessed with SDS-PAGE and/or MALDI-TOF MS. The sample was then dialyzed (molecular weight cut off 6,000–8,000 kDa) in 1 L of SUMO buffer (50 mM NaH2PO4, 150 mM NaCl, 1 mM DTT, pH 8) at 4 °C for 4 h with two buffer changes to remove imidazole, reducing agents, arginine, and EDTA. The sample was then removed to a glass vial and His-tagged SUMO protease was added (McLab, South San Francisco, CA, 1000 units/500 mL culture media). The sample was gently rotated at 4 °C for 2–4 h, and cleavage progress was assessed with MALDI-TOF MS. The His6-SUMO tag, His-tagged SUMO protease, and His-tagged intein were then removed with a second Ni-NTA column at 4 °C. The flow through and wash fractions were pooled and then the crude peptide was lyophilized and redissolved in an acetonitrile/water mixture with 0.1% trifluoroacetic acid. The peptide was further purified using semi-preparative HPLC and then lyophilized to obtain a final yield of purified peptide per L of culture media.
HPLC purification methods
HPLC purification was completed with aqueous 0.1% trifluoroacetic acid (TFA) (solvent A) and 0.1% TFA in acetonitrile (solvent B) as eluents. Semi-prep purification and reinjection analyses were conducted at a flow rate of 5 mL/min with wavelength monitoring at 220, 254, and 280 nm. Peptide purity was confirmed by both MALDI-TOF MS and HPLC reinjection of a sample of the pooled peptide-containing fractions. LeuA was stirred overnight in 1 mM TCEP prior to HPLC injection to reduce disulfide bonds. LeuA MS (MALDI-TOF) Calculated for C174H248N52O50S2 3929.8, found 3930.9 (M + H)+. LcnA MS (MALDI-TOF) Calculated for C260H380N72O77S1 5774.8, found 5775.9 (M + H)+. HPLC Method 1 (LeuA purification, peptide elutes at 39% B): 0 − 8 min, 15% B; 8 − 20 min, ramp 15 − 60% B; 20–20.5 min, ramp 60 − 100% B; 20.5 − 24 min, 100% B. HPLC Method 2 (LcnA purification, peptide eluted at 42% B): 0 − 4 min, 20% B; 4 − 13 min, ramp 20 − 46% B; 13–13.5 min, ramp 46 − 100% B; 13.5 − 20 min, 100% B.
Screen of buffer additives to prevent protein precipitation during intein cleavage
This screen was adapted based on a literature procedure [ref. 41]. SPI fusion proteins were initially expressed and isolated with the first Ni-NTA column as described above. The Ni-NTA column was eluted with 30 mL of lysis buffer (50 mM NaH2PO4, 300 mM NaCl, pH 8.0) with 150 mM imidazole added. 1 mL aliquots were portioned into microcentrifuge tubes at 4 °C. Additives were added as dry powders or neat liquids, and pH was readjusted to 8.5 after addition if needed. The samples were gently shaken for 72 h at 4 °C, and then centrifuged (2 min, 13,000 × g, 4 °C) to pellet any insoluble protein. Samples for SDS-PAGE were taken from the soluble supernatant fraction, or the supernatant was removed and a sample was taken from the insoluble pellet resuspended in 1 mL of water.
Supplementary Materials
References
- K Keymanesh, S Soltani, S Sardari. Application of antimicrobial peptides in agriculture and food industry. World J Microbiol Biotechnol, 2009. [DOI]
- DJ Craik, M-W Kan. How can we improve peptide drug discovery? Learning from the past. Expert Opin Drug Discov, 2021. [DOI | PubMed]
- AL Madrazo, MRS Campos. Review of antimicrobial peptides as promoters of food safety: Limitations and possibilities within the food industry. J Food Saf, 2020
- A Tinoco, M Martins, A Cavaco-Paulo, A Ribeiro. Biotechnology of functional proteins and peptides for hair cosmetic formulations. Trends Biotechnol, 2022. [DOI | PubMed]
- V Martin, PHG Egelund, H Johansson, S Le Thordal, F Wojcik, D Sejer Pedersen. Greening the synthesis of peptide therapeutics: an industrial perspective. RSC Adv, 2020. [DOI | PubMed]
- D Agyei, MK Danquah. Industrial-scale manufacturing of pharmaceutical-grade bioactive peptides. Biotechnol Adv, 2011. [DOI | PubMed]
- Y Zhang, M Chen, SD Bruner, Y Ding. Heterologous production of Microbial Ribosomally synthesized and post-translationally modified peptides. Front Microbiol, 2018. [DOI | PubMed]
- J Kaur, A Kumar, J Kaur. Strategies for optimization of heterologous protein expression in E. coli: Roadblocks and reinforcements. Int J Biol Macromol, 2018. [DOI | PubMed]
- M-R Ki, SP Pack. Fusion tags to enhance heterologous protein expression. Appl Microbiol Biotechnol, 2020. [DOI | PubMed]
- 10.Kimple ME, Brill AL, Pasker RL. Overview of Affinity Tags for Protein Purification. Curr Protoc Protein Sci. 2013;73:9.9.1–9.9.23.
- DS Waugh. Making the most of affinity tags. Trends Biotechnol, 2005. [DOI | PubMed]
- DS Waugh. An overview of enzymatic reagents for the removal of affinity tags. Protein Expr Purif, 2011. [DOI | PubMed]
- TR Butt, SC Edavettal, JP Hall, MR Mattern. SUMO fusion technology for difficult-to-express proteins. Protein Expr Purif, 2005. [DOI | PubMed]
- NH Shah, TW Muir. Inteins: nature’s gift to protein chemists. Chem Sci, 2014. [DOI | PubMed]
- S Nallamsetty, BP Austin, KJ Penrose, DS Waugh. Gateway vectors for the production of combinatorially-tagged His6-MBP fusion proteins in the cytoplasm and periplasm of Escherichia coli. Protein Sci, 2005. [DOI | PubMed]
- D Needle, DS Waugh. Rescuing aggregation-prone proteins in Escherichia coli with a dual His6-MBP tag. Protein Affinity Tags: methods and protocols, 2014
- S Raran-Kurussi, DS Waugh. Expression and purification of recombinant proteins in Escherichia coli with a His6 or dual His6-MBP tag. Protein crystallography: methods and protocols, 2017
- S Nallamsetty, DS Waugh. A generic protocol for the expression and purification of recombinant proteins in Escherichia coli using a combinatorial His6-maltose binding protein fusion tag. Nat Protoc, 2007. [DOI | PubMed]
- B Hang, J Pan, D Ni, Q Zheng, X Zhang, J Cai, L Huang, P Wei, Z Xu. High-level production of aquaporin Z in Escherichia coli using maltose-binding protein/polyhistidine dual-affinity tag fusion system. Process Biochem, 2016. [DOI]
- P Sun, JE Tropea, DS Waugh. Enhancing the solubility of recombinant proteins in Escherichia coli by using hexahistidine-tagged maltose-binding protein as a Fusion Partner. Heterologous gene expression in E.coli: methods and protocols, 2011
- GA Stamsås, LS Håvarstein, D Straume. CHiC, a new tandem affinity tag for the protein purification toolbox. J Microbiol Methods, 2013. [DOI | PubMed]
- SS Ashraf, RE Benson, ES Payne, CM Halbleib, H Grøn. A novel multi-affinity tag system to produce high levels of soluble and biotinylated proteins in Escherichia coli. Protein Expr Purif, 2004. [DOI | PubMed]
- J Zhang, X Lv, R Xu, X Tao, Y Dong, A Sun, D Wei. Soluble expression, rapid purification, and characterization of human interleukin-24 (IL-24) using a MBP-SUMO dual fusion system in Escherichia coli. Appl Microbiol Biotechnol, 2015. [DOI | PubMed]
- S Rao, X Zang, Z Yang, L Gao, Y Yin, W Fang. Soluble expression and purification of the recombinant bioactive peptide precursor BPP-1 in Escherichia coli using a cELP-SUMO dual fusion system. Protein Expr Purif, 2016. [DOI | PubMed]
- S Zahran, JS Pan, PB Liu, PM Hwang. Combining a PagP fusion protein system with nickel ion-catalyzed cleavage to produce intrinsically disordered proteins in E. coli. Protein Expr Purif, 2015. [DOI | PubMed]
- V Sadr, B Saffar, R Emamzadeh. Functional expression and purification of recombinant Hepcidin25 production in Escherichia coli using SUMO fusion technology. Gene, 2017. [DOI | PubMed]
- Y Li. Production of human antimicrobial peptide LL-37 in Escherichia coli using a thioredoxin–SUMO dual fusion system. Protein Expr Purif, 2013. [DOI | PubMed]
- F Guerrero, A Ciragan, H Iwaï. Tandem SUMO fusion vectors for improving soluble protein expression and purification. Protein Expr Purif, 2015. [DOI | PubMed]
- Z Wang, N Li, Y Wang, Y Wu, T Mu, Y Zheng, L Huang, X Fang. Ubiquitin-intein and SUMO2-intein fusion systems for enhanced protein production and purification. Protein Expr Purif, 2012. [DOI | PubMed]
- 30.Hammarberg B, Nygren PA, Holmgren E, Elmblad A, Tally M, Hellman U, Moks T, Uhlén M. (1989) Dual affinity fusion approach and its use to express recombinant human insulin-like growth factor II. Proceedings of the National Academy of Sciences 86:4367–4371
- L Huang, X Qu, Y Chen, W Xu, C Huang. Sandwiched-fusion strategy facilitates recombinant production of small labile proteins. Protein Sci, 2021. [DOI | PubMed]
- J Jarmander, M Gustavsson, T-H Do, P Samuelson, G Larsson. A dual tag system for facilitated detection of surface expressed proteins in Escherichia coli. Microb Cell Fact, 2012. [DOI | PubMed]
- DP Ryan, DJ Tremethick. A dual affinity-tag strategy for the expression and purification of human linker histone H1.4 in Escherichia coli. Protein Expr Purif, 2016. [DOI | PubMed]
- V-S Raducanu, D-V Raducanu, Y Ouyang, M Tehseen, M Takahashi, SM Hamdan. TSGIT: An N- and C-terminal tandem tag system for purification of native and intein-mediated ligation-ready proteins. Protein Sci, 2021. [DOI | PubMed]
- A Osunsade, NA Prescott, JM Hebert, DM Ray, Y Jmeian, IC Lorenz, Y David. A robust method for the purification and characterization of recombinant human histone H1 variants. Biochemistry, 2019. [DOI | PubMed]
- T Lamer, MJ van Belkum, A Wijewardane, S Chiorean, LA Martin-Visscher, JC Vederas. SPI “sandwich”: combined SUMO-Peptide-intein expression system and isolation procedure for improved stability and yield of peptides. Protein Sci, 2022. [DOI | PubMed]
- T Lamer, MJ van Belkum, JC Vederas. Methods for recombinant production and purification of peptides as SUMO-Peptide-Intein Fusion Proteins to protect from degradation. Curr Protoc, 2022. [DOI | PubMed]
- MW Southworth, K Amaya, TC Evans, M-Q Xu, FB Perler. Purification of proteins fused to either the amino or Carboxy Terminus of the Mycobacterium xenopi Gyrase A Intein. Biotechniques, 1999. [DOI | PubMed]
- JA Gramespacher, AJ Stevens, RE Thompson, TW Muir. Improved protein splicing using embedded split inteins. Protein Sci, 2018. [DOI | PubMed]
- EA Peroza, E Freisinger. Tris is a non-innocent buffer during intein-mediated protein cleavage. Protein Expr Purif, 2008. [DOI | PubMed]
- KA Churion, SE Bondos. Identifying solubility-promoting buffers for intrinsically disordered proteins prior to purification. Intrinsically disordered protein analysis: volume 2, methods and experimental tools, 2012
